Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EG47

Protein Details
Accession J6EG47   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-103EGEALLKRRKNIRKANRQRIKQSNFLSHydrophilic
NLS Segment(s)
PositionSequence
83-94KRRKNIRKANRQ
Subcellular Location(s) mito 18.5, mito_nucl 13.666, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.42
4 0.43
5 0.49
6 0.52
7 0.48
8 0.45
9 0.4
10 0.36
11 0.36
12 0.34
13 0.28
14 0.25
15 0.24
16 0.2
17 0.2
18 0.18
19 0.15
20 0.12
21 0.12
22 0.11
23 0.15
24 0.18
25 0.17
26 0.18
27 0.18
28 0.18
29 0.16
30 0.17
31 0.12
32 0.11
33 0.11
34 0.12
35 0.16
36 0.16
37 0.16
38 0.16
39 0.16
40 0.15
41 0.16
42 0.13
43 0.09
44 0.09
45 0.08
46 0.06
47 0.08
48 0.11
49 0.14
50 0.18
51 0.18
52 0.18
53 0.17
54 0.17
55 0.17
56 0.15
57 0.13
58 0.11
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.07
65 0.06
66 0.06
67 0.13
68 0.17
69 0.2
70 0.24
71 0.34
72 0.43
73 0.52
74 0.63
75 0.67
76 0.74
77 0.83
78 0.9
79 0.91
80 0.91
81 0.91
82 0.91
83 0.86
84 0.84
85 0.79