Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NM58

Protein Details
Accession A0A165NM58    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
247-269RDKVLPPKLKGWKEKKADKENQGBasic
NLS Segment(s)
PositionSequence
255-262LKGWKEKK
Subcellular Location(s) cyto 18, cyto_nucl 11.5, nucl 3, mito 3
Family & Domain DBs
Amino Acid Sequences MEAPPSQASQVAFDKCKAPSGEVGNGKRTLKKLKLSLQNPLSGLSPSIMMPAGVDGITAPSSSIVLPAVPVVAAPAPPLSPAWVPSPVPDDVDTSAVETISDTAMTGTKGSMDNMGGNELDPSIDNTSLSNSATTALNDTAVIVDPTINACKASVSAGPEALVSAGPEASTSLGLSAQGGDTGAILNVGCKKRATMAAPMQKLVDLRTARLLFVADHLTEHPNITESQVQWAWMAFLPEQKKVYEDRDKVLPPKLKGWKEKKADKENQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.37
4 0.33
5 0.3
6 0.3
7 0.34
8 0.41
9 0.46
10 0.49
11 0.47
12 0.51
13 0.51
14 0.49
15 0.48
16 0.49
17 0.48
18 0.52
19 0.55
20 0.6
21 0.67
22 0.66
23 0.71
24 0.66
25 0.63
26 0.55
27 0.48
28 0.4
29 0.3
30 0.27
31 0.18
32 0.14
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.04
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.07
66 0.08
67 0.08
68 0.1
69 0.12
70 0.15
71 0.15
72 0.16
73 0.19
74 0.17
75 0.18
76 0.17
77 0.16
78 0.14
79 0.15
80 0.14
81 0.11
82 0.11
83 0.09
84 0.08
85 0.07
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.08
104 0.07
105 0.07
106 0.06
107 0.06
108 0.05
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.08
115 0.09
116 0.09
117 0.07
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.07
141 0.08
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.1
148 0.08
149 0.07
150 0.04
151 0.04
152 0.04
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.05
174 0.11
175 0.13
176 0.14
177 0.14
178 0.15
179 0.18
180 0.23
181 0.24
182 0.26
183 0.35
184 0.42
185 0.43
186 0.43
187 0.4
188 0.37
189 0.35
190 0.28
191 0.26
192 0.18
193 0.18
194 0.25
195 0.25
196 0.24
197 0.24
198 0.23
199 0.16
200 0.17
201 0.19
202 0.11
203 0.12
204 0.14
205 0.15
206 0.15
207 0.16
208 0.14
209 0.12
210 0.13
211 0.14
212 0.17
213 0.15
214 0.21
215 0.21
216 0.21
217 0.2
218 0.2
219 0.19
220 0.15
221 0.17
222 0.12
223 0.18
224 0.2
225 0.25
226 0.26
227 0.25
228 0.26
229 0.28
230 0.36
231 0.4
232 0.4
233 0.4
234 0.46
235 0.51
236 0.53
237 0.58
238 0.57
239 0.5
240 0.56
241 0.62
242 0.63
243 0.69
244 0.74
245 0.75
246 0.77
247 0.83
248 0.84
249 0.85