Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165TRS3

Protein Details
Accession A0A165TRS3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TSSSGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
14-32SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MQAKAKAAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVALDKPTFDRIIKEVPTFRFISQSILIERLKVNGSLARRAIRHLEKEGLIKRIVHHSDQLIYTRITTGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.28
4 0.34
5 0.4
6 0.45
7 0.54
8 0.62
9 0.7
10 0.77
11 0.81
12 0.84
13 0.86
14 0.9
15 0.9
16 0.91
17 0.88
18 0.83
19 0.8
20 0.7
21 0.63
22 0.52
23 0.47
24 0.39
25 0.36
26 0.3
27 0.23
28 0.22
29 0.2
30 0.2
31 0.16
32 0.14
33 0.12
34 0.17
35 0.18
36 0.19
37 0.22
38 0.22
39 0.25
40 0.25
41 0.23
42 0.21
43 0.19
44 0.21
45 0.18
46 0.18
47 0.15
48 0.18
49 0.17
50 0.16
51 0.16
52 0.14
53 0.14
54 0.12
55 0.13
56 0.12
57 0.15
58 0.18
59 0.2
60 0.22
61 0.22
62 0.24
63 0.31
64 0.33
65 0.35
66 0.35
67 0.36
68 0.35
69 0.42
70 0.44
71 0.39
72 0.35
73 0.32
74 0.3
75 0.36
76 0.37
77 0.32
78 0.32
79 0.31
80 0.33
81 0.34
82 0.35
83 0.28
84 0.25
85 0.24
86 0.21