Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SI68

Protein Details
Accession A0A165SI68   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
7-28YSKGRVLGHKRGKRNTHPNTTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 12, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRGKRNTHPNTTLLQIEGVGSKEDAQFYLGKRVAYVYRAKTERLGSKVRVIWGRVSRPHGNSGVVKAKFRHNMPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.75
5 0.79
6 0.8
7 0.84
8 0.82
9 0.82
10 0.78
11 0.71
12 0.64
13 0.58
14 0.48
15 0.38
16 0.28
17 0.18
18 0.14
19 0.12
20 0.11
21 0.08
22 0.07
23 0.08
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.23
38 0.19
39 0.23
40 0.24
41 0.25
42 0.26
43 0.29
44 0.3
45 0.3
46 0.31
47 0.27
48 0.31
49 0.33
50 0.34
51 0.32
52 0.29
53 0.31
54 0.33
55 0.36
56 0.36
57 0.4
58 0.42
59 0.41
60 0.44
61 0.39
62 0.37
63 0.33
64 0.35
65 0.37
66 0.33
67 0.34
68 0.32
69 0.38
70 0.41
71 0.42
72 0.47
73 0.44
74 0.53
75 0.56
76 0.6
77 0.54
78 0.49
79 0.47
80 0.36
81 0.35
82 0.26
83 0.21
84 0.16
85 0.14
86 0.13