Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165SUH8

Protein Details
Accession A0A165SUH8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-79SPTPAPPIPRKPKYRPRAPIRKPTTGKPHydrophilic
NLS Segment(s)
PositionSequence
58-84PIPRKPKYRPRAPIRKPTTGKPVKPVR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGGLEVPTQMSVSQQSQAPGVPSSQPPPSPCVHPKYGRVEPLTYPFTSHSMSPTPAPPIPRKPKYRPRAPIRKPTTGKPVKPVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.18
5 0.18
6 0.15
7 0.15
8 0.15
9 0.15
10 0.18
11 0.2
12 0.22
13 0.21
14 0.24
15 0.25
16 0.29
17 0.32
18 0.34
19 0.38
20 0.39
21 0.43
22 0.48
23 0.5
24 0.48
25 0.45
26 0.41
27 0.36
28 0.37
29 0.33
30 0.25
31 0.22
32 0.19
33 0.19
34 0.18
35 0.17
36 0.14
37 0.14
38 0.15
39 0.15
40 0.16
41 0.18
42 0.19
43 0.23
44 0.27
45 0.35
46 0.44
47 0.51
48 0.59
49 0.65
50 0.74
51 0.79
52 0.85
53 0.85
54 0.85
55 0.88
56 0.88
57 0.89
58 0.86
59 0.87
60 0.81
61 0.77
62 0.78
63 0.76
64 0.72