Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PQU5

Protein Details
Accession A0A165PQU5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-128VRRAPTPPVRTSRKRKSRPTQTPARTRNLRCHydrophilic
NLS Segment(s)
PositionSequence
107-116RTSRKRKSRP
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVEGPRNAGESLEEWDDVPQDLPDSTPVHRNKPQQSVTEPDYTQNLKSLVPGASLLLLHRSGSARADNGGKWRRRILCLVTYPPAPPTQQSMQNTPFVRRAPTPPVRTSRKRKSRPTQTPARTRNLRCGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.14
5 0.13
6 0.1
7 0.09
8 0.09
9 0.09
10 0.11
11 0.13
12 0.14
13 0.22
14 0.25
15 0.31
16 0.38
17 0.45
18 0.49
19 0.56
20 0.59
21 0.56
22 0.56
23 0.55
24 0.53
25 0.5
26 0.43
27 0.35
28 0.34
29 0.31
30 0.27
31 0.24
32 0.2
33 0.15
34 0.15
35 0.16
36 0.13
37 0.12
38 0.11
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.09
50 0.1
51 0.08
52 0.09
53 0.11
54 0.11
55 0.18
56 0.25
57 0.26
58 0.28
59 0.34
60 0.35
61 0.36
62 0.39
63 0.35
64 0.35
65 0.37
66 0.38
67 0.35
68 0.33
69 0.31
70 0.29
71 0.26
72 0.2
73 0.16
74 0.18
75 0.2
76 0.26
77 0.29
78 0.34
79 0.35
80 0.41
81 0.41
82 0.39
83 0.39
84 0.33
85 0.34
86 0.31
87 0.33
88 0.36
89 0.44
90 0.47
91 0.49
92 0.57
93 0.63
94 0.7
95 0.75
96 0.77
97 0.79
98 0.83
99 0.87
100 0.89
101 0.92
102 0.93
103 0.91
104 0.91
105 0.9
106 0.91
107 0.87
108 0.86
109 0.84
110 0.77