Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SLF2

Protein Details
Accession A0A165SLF2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
107-141QSTVRKETVKRKRTPIPSINEPKPKRRATRASLKPHydrophilic
NLS Segment(s)
PositionSequence
115-141VKRKRTPIPSINEPKPKRRATRASLKP
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 8.5, mito 2, plas 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR043145  Znf_ZZ_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Amino Acid Sequences MAMFSGFVCGHCENTVGGPFWRCVECVSFDICDRCAHNSQHTLLRIETVEDVKALMQDAYGKGAHPEDCEITIGLRVYTLKDAEPTIRGSLRQGQILRGIFNQQSSQSTVRKETVKRKRTPIPSINEPKPKRRATRASLKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.16
4 0.17
5 0.17
6 0.18
7 0.19
8 0.2
9 0.17
10 0.16
11 0.17
12 0.19
13 0.19
14 0.2
15 0.19
16 0.2
17 0.21
18 0.21
19 0.2
20 0.18
21 0.21
22 0.25
23 0.26
24 0.29
25 0.31
26 0.33
27 0.37
28 0.37
29 0.35
30 0.29
31 0.28
32 0.23
33 0.2
34 0.19
35 0.14
36 0.12
37 0.1
38 0.1
39 0.08
40 0.08
41 0.07
42 0.05
43 0.05
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.09
53 0.1
54 0.09
55 0.09
56 0.1
57 0.09
58 0.07
59 0.08
60 0.07
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.08
67 0.07
68 0.08
69 0.09
70 0.1
71 0.11
72 0.12
73 0.13
74 0.13
75 0.13
76 0.15
77 0.21
78 0.22
79 0.25
80 0.24
81 0.23
82 0.28
83 0.29
84 0.28
85 0.21
86 0.23
87 0.19
88 0.2
89 0.2
90 0.16
91 0.17
92 0.2
93 0.23
94 0.23
95 0.25
96 0.27
97 0.3
98 0.35
99 0.4
100 0.47
101 0.54
102 0.61
103 0.65
104 0.7
105 0.75
106 0.78
107 0.81
108 0.79
109 0.76
110 0.77
111 0.8
112 0.81
113 0.82
114 0.78
115 0.77
116 0.78
117 0.79
118 0.76
119 0.77
120 0.78
121 0.76