Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4TZ95

Protein Details
Accession J4TZ95    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-78PDEPQHTEENKKRKLPRKEVIKTKTKIBasic
NLS Segment(s)
PositionSequence
62-79KKRKLPRKEVIKTKTKIA
434-441KRRSKKTK
Subcellular Location(s) mito 15.5, mito_nucl 14, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR041707  Pus3-like  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
CDD cd02569  PseudoU_synth_ScPus3  
Amino Acid Sequences MSGFIKRLVGKMKTVSAGNSIGNKMDSVYVNWTKEQLIRRIAELENANKQHPDEPQHTEENKKRKLPRKEVIKTKTKIAQKKFDFSRHNTRLIALRFAYLGWNYNGLAIQKEYTPLPTVEGIILEAMNKCKLVPSLVLQEYKFSRCGRTDKGVSAMNQVISLKVRSNLTNEEQLDSANDCREISYVRVLNQLLPDDIRISAVCLRPPPDFDARFSCVHRHYKYVFNGKNLNIDKMSKAASYFLGENDFRNFCKLDGSKQITNFKRTMLSSKILPLSDTFYCFDLIGSAFLWHQVRCMMAILFLAGQELEEPEMVLRLLDIEKTPQRPIYDMADDIPLLLYDCEFPQLEWQETAVDDCKSIRVTTATEALTLHYGLKAMVSNIFKDVLPTADTNNFTKTIINLGDGKGKIVGNYVKLKDRSVMESVEAVNDKYSKRRSKKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.34
4 0.34
5 0.32
6 0.32
7 0.28
8 0.26
9 0.25
10 0.23
11 0.2
12 0.21
13 0.19
14 0.17
15 0.24
16 0.29
17 0.3
18 0.31
19 0.32
20 0.3
21 0.34
22 0.39
23 0.37
24 0.39
25 0.38
26 0.39
27 0.42
28 0.4
29 0.41
30 0.4
31 0.38
32 0.4
33 0.41
34 0.4
35 0.37
36 0.38
37 0.36
38 0.36
39 0.38
40 0.34
41 0.39
42 0.43
43 0.5
44 0.52
45 0.57
46 0.59
47 0.63
48 0.65
49 0.67
50 0.71
51 0.73
52 0.81
53 0.82
54 0.83
55 0.84
56 0.86
57 0.88
58 0.87
59 0.88
60 0.79
61 0.76
62 0.74
63 0.71
64 0.71
65 0.68
66 0.7
67 0.65
68 0.72
69 0.72
70 0.74
71 0.73
72 0.71
73 0.74
74 0.69
75 0.68
76 0.59
77 0.54
78 0.53
79 0.47
80 0.44
81 0.34
82 0.29
83 0.24
84 0.24
85 0.24
86 0.17
87 0.18
88 0.13
89 0.14
90 0.13
91 0.14
92 0.15
93 0.13
94 0.14
95 0.12
96 0.12
97 0.11
98 0.12
99 0.12
100 0.12
101 0.14
102 0.13
103 0.14
104 0.14
105 0.14
106 0.13
107 0.12
108 0.11
109 0.09
110 0.08
111 0.07
112 0.08
113 0.09
114 0.09
115 0.09
116 0.09
117 0.1
118 0.11
119 0.12
120 0.12
121 0.14
122 0.22
123 0.25
124 0.29
125 0.27
126 0.3
127 0.3
128 0.3
129 0.31
130 0.24
131 0.24
132 0.26
133 0.31
134 0.33
135 0.38
136 0.39
137 0.37
138 0.4
139 0.39
140 0.36
141 0.35
142 0.31
143 0.23
144 0.21
145 0.19
146 0.16
147 0.14
148 0.14
149 0.11
150 0.12
151 0.14
152 0.14
153 0.17
154 0.2
155 0.22
156 0.27
157 0.26
158 0.25
159 0.24
160 0.22
161 0.2
162 0.17
163 0.16
164 0.1
165 0.1
166 0.08
167 0.09
168 0.09
169 0.09
170 0.09
171 0.14
172 0.14
173 0.15
174 0.19
175 0.19
176 0.19
177 0.2
178 0.19
179 0.14
180 0.12
181 0.12
182 0.09
183 0.09
184 0.08
185 0.07
186 0.07
187 0.11
188 0.12
189 0.13
190 0.14
191 0.16
192 0.16
193 0.18
194 0.2
195 0.23
196 0.23
197 0.24
198 0.27
199 0.28
200 0.3
201 0.29
202 0.29
203 0.28
204 0.34
205 0.33
206 0.33
207 0.32
208 0.37
209 0.42
210 0.48
211 0.46
212 0.42
213 0.45
214 0.42
215 0.47
216 0.41
217 0.37
218 0.28
219 0.27
220 0.23
221 0.2
222 0.2
223 0.12
224 0.11
225 0.11
226 0.1
227 0.11
228 0.11
229 0.1
230 0.12
231 0.12
232 0.13
233 0.15
234 0.15
235 0.14
236 0.15
237 0.15
238 0.12
239 0.18
240 0.18
241 0.19
242 0.27
243 0.33
244 0.34
245 0.38
246 0.47
247 0.44
248 0.47
249 0.44
250 0.36
251 0.34
252 0.32
253 0.32
254 0.27
255 0.26
256 0.23
257 0.26
258 0.27
259 0.24
260 0.23
261 0.19
262 0.19
263 0.18
264 0.19
265 0.16
266 0.14
267 0.15
268 0.14
269 0.13
270 0.1
271 0.1
272 0.08
273 0.07
274 0.07
275 0.06
276 0.09
277 0.11
278 0.09
279 0.1
280 0.1
281 0.1
282 0.1
283 0.11
284 0.08
285 0.07
286 0.08
287 0.07
288 0.07
289 0.06
290 0.06
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.05
300 0.05
301 0.04
302 0.04
303 0.05
304 0.05
305 0.06
306 0.07
307 0.12
308 0.17
309 0.2
310 0.22
311 0.24
312 0.25
313 0.26
314 0.29
315 0.29
316 0.27
317 0.25
318 0.24
319 0.22
320 0.2
321 0.19
322 0.16
323 0.1
324 0.08
325 0.07
326 0.06
327 0.06
328 0.06
329 0.09
330 0.09
331 0.09
332 0.15
333 0.18
334 0.2
335 0.19
336 0.19
337 0.18
338 0.18
339 0.2
340 0.16
341 0.13
342 0.12
343 0.12
344 0.14
345 0.14
346 0.14
347 0.14
348 0.13
349 0.15
350 0.17
351 0.22
352 0.2
353 0.2
354 0.2
355 0.19
356 0.18
357 0.17
358 0.14
359 0.09
360 0.09
361 0.08
362 0.09
363 0.09
364 0.09
365 0.14
366 0.15
367 0.16
368 0.17
369 0.19
370 0.17
371 0.18
372 0.18
373 0.14
374 0.15
375 0.15
376 0.17
377 0.22
378 0.25
379 0.25
380 0.27
381 0.26
382 0.24
383 0.24
384 0.21
385 0.21
386 0.2
387 0.21
388 0.2
389 0.21
390 0.28
391 0.27
392 0.27
393 0.25
394 0.24
395 0.22
396 0.25
397 0.27
398 0.26
399 0.34
400 0.37
401 0.42
402 0.43
403 0.45
404 0.44
405 0.44
406 0.43
407 0.38
408 0.36
409 0.29
410 0.31
411 0.3
412 0.3
413 0.27
414 0.23
415 0.22
416 0.24
417 0.24
418 0.3
419 0.39
420 0.45
421 0.53