Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165RW54

Protein Details
Accession A0A165RW54   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
270-296DLTKEFEIKKQRNKNTNRTRLVRKARPHydrophilic
NLS Segment(s)
PositionSequence
398-404RRGPPRG
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MSSNVPFRESDITAPTPQNTPLTQAPIAQGLSRPTVPDISEDNEGEEDASSPTAGLAGGMLAGLVQGKLSGLIGKSSGYIESLPVEVKMKVEALKGVQVKQDELQNQYKRECLELEKKYAELQKPLLDRRHAIITGTALPTAEEVEAGETVSKKDDEEYTPLPKDISDSTTKGIPEFWLTALRNHVALSGIITDRDAGALKHLSDIRLSYLPSTDPKPGFKLSFYFTPNEYFENEVLEKTYIYQEEVGYSGDFVYDRAIGTEIKWKEDKDLTKEFEIKKQRNKNTNRTRLVRKARPTESFFNFFGPPEPPADEAIENGEIDVDELEELEEKLEIDYQLGEDIKEKIIPKAVDYFTGKALEYETMDDDDDDFEDIDEEDDEDRFEDDDSDSDGDVPVRRRGPPRGRGAGGAAPNVNAEECKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.33
5 0.34
6 0.28
7 0.29
8 0.29
9 0.32
10 0.31
11 0.31
12 0.3
13 0.29
14 0.29
15 0.25
16 0.24
17 0.21
18 0.24
19 0.23
20 0.22
21 0.21
22 0.23
23 0.22
24 0.23
25 0.23
26 0.23
27 0.26
28 0.25
29 0.25
30 0.22
31 0.22
32 0.19
33 0.15
34 0.13
35 0.09
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.12
73 0.11
74 0.12
75 0.12
76 0.13
77 0.13
78 0.14
79 0.15
80 0.15
81 0.21
82 0.23
83 0.24
84 0.25
85 0.24
86 0.25
87 0.25
88 0.29
89 0.26
90 0.29
91 0.36
92 0.38
93 0.41
94 0.41
95 0.41
96 0.36
97 0.35
98 0.32
99 0.3
100 0.34
101 0.35
102 0.39
103 0.38
104 0.37
105 0.4
106 0.44
107 0.4
108 0.34
109 0.33
110 0.32
111 0.37
112 0.42
113 0.43
114 0.39
115 0.38
116 0.37
117 0.39
118 0.33
119 0.28
120 0.24
121 0.21
122 0.21
123 0.2
124 0.17
125 0.12
126 0.12
127 0.12
128 0.11
129 0.09
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.08
139 0.08
140 0.07
141 0.09
142 0.12
143 0.13
144 0.18
145 0.21
146 0.25
147 0.26
148 0.26
149 0.24
150 0.21
151 0.21
152 0.17
153 0.18
154 0.16
155 0.17
156 0.18
157 0.2
158 0.2
159 0.18
160 0.17
161 0.14
162 0.12
163 0.12
164 0.11
165 0.15
166 0.15
167 0.17
168 0.19
169 0.18
170 0.17
171 0.16
172 0.15
173 0.1
174 0.09
175 0.08
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.06
186 0.07
187 0.07
188 0.1
189 0.11
190 0.1
191 0.1
192 0.11
193 0.11
194 0.12
195 0.12
196 0.1
197 0.1
198 0.1
199 0.12
200 0.14
201 0.16
202 0.16
203 0.17
204 0.2
205 0.22
206 0.21
207 0.2
208 0.21
209 0.19
210 0.22
211 0.23
212 0.22
213 0.2
214 0.23
215 0.23
216 0.22
217 0.2
218 0.17
219 0.15
220 0.16
221 0.15
222 0.12
223 0.12
224 0.11
225 0.1
226 0.09
227 0.11
228 0.08
229 0.09
230 0.1
231 0.09
232 0.09
233 0.1
234 0.1
235 0.08
236 0.07
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.05
243 0.05
244 0.06
245 0.07
246 0.07
247 0.08
248 0.16
249 0.15
250 0.18
251 0.2
252 0.2
253 0.23
254 0.29
255 0.32
256 0.31
257 0.38
258 0.37
259 0.39
260 0.46
261 0.44
262 0.46
263 0.52
264 0.52
265 0.55
266 0.62
267 0.67
268 0.7
269 0.77
270 0.8
271 0.82
272 0.85
273 0.84
274 0.81
275 0.81
276 0.81
277 0.83
278 0.8
279 0.77
280 0.76
281 0.74
282 0.73
283 0.71
284 0.68
285 0.63
286 0.6
287 0.51
288 0.45
289 0.4
290 0.33
291 0.29
292 0.23
293 0.19
294 0.16
295 0.17
296 0.15
297 0.16
298 0.18
299 0.16
300 0.15
301 0.16
302 0.15
303 0.13
304 0.12
305 0.1
306 0.08
307 0.08
308 0.07
309 0.05
310 0.04
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.05
317 0.05
318 0.06
319 0.08
320 0.07
321 0.07
322 0.07
323 0.07
324 0.1
325 0.1
326 0.1
327 0.1
328 0.12
329 0.12
330 0.16
331 0.16
332 0.16
333 0.22
334 0.22
335 0.23
336 0.29
337 0.29
338 0.31
339 0.34
340 0.33
341 0.3
342 0.31
343 0.29
344 0.21
345 0.22
346 0.18
347 0.16
348 0.16
349 0.15
350 0.14
351 0.15
352 0.14
353 0.14
354 0.12
355 0.12
356 0.11
357 0.09
358 0.08
359 0.08
360 0.08
361 0.08
362 0.08
363 0.08
364 0.08
365 0.08
366 0.08
367 0.08
368 0.09
369 0.09
370 0.09
371 0.09
372 0.09
373 0.11
374 0.13
375 0.14
376 0.13
377 0.13
378 0.14
379 0.14
380 0.18
381 0.21
382 0.24
383 0.27
384 0.33
385 0.39
386 0.49
387 0.57
388 0.62
389 0.68
390 0.7
391 0.69
392 0.66
393 0.64
394 0.6
395 0.53
396 0.48
397 0.38
398 0.3
399 0.28
400 0.26
401 0.22
402 0.16