Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UFE8

Protein Details
Accession A0A165UFE8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
PositionSequence
40-65KRRYDRKQTGYGGQKKPVFHKKAKTT
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSLVAQGKRRYDRKQTGYGGQKKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALTFVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.87
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.89
12 0.85
13 0.87
14 0.86
15 0.81
16 0.75
17 0.7
18 0.61
19 0.54
20 0.52
21 0.51
22 0.5
23 0.49
24 0.49
25 0.5
26 0.53
27 0.56
28 0.57
29 0.53
30 0.53
31 0.57
32 0.59
33 0.61
34 0.59
35 0.6
36 0.64
37 0.68
38 0.61
39 0.57
40 0.55
41 0.48
42 0.52
43 0.54
44 0.5
45 0.46
46 0.52
47 0.56
48 0.64
49 0.72
50 0.72
51 0.69
52 0.7
53 0.74
54 0.73
55 0.7
56 0.66
57 0.61
58 0.58
59 0.56
60 0.51
61 0.46
62 0.43
63 0.38
64 0.32
65 0.3
66 0.29
67 0.34
68 0.4
69 0.43
70 0.46
71 0.56
72 0.63
73 0.69
74 0.66
75 0.61
76 0.57
77 0.52
78 0.52
79 0.52
80 0.52
81 0.53
82 0.56
83 0.53
84 0.49
85 0.48
86 0.42
87 0.32
88 0.25
89 0.22