Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165TTU9

Protein Details
Accession A0A165TTU9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-32DSLGQTLRRRQKIQRKKYSVPRPNYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences LSLRRVDSLGQTLRRRQKIQRKKYSVPRPNYLWHCDGHHKLIWWGIVIHGFIDGYCRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.65
4 0.69
5 0.72
6 0.78
7 0.81
8 0.8
9 0.82
10 0.88
11 0.89
12 0.87
13 0.82
14 0.77
15 0.69
16 0.67
17 0.63
18 0.57
19 0.47
20 0.39
21 0.36
22 0.37
23 0.36
24 0.33
25 0.3
26 0.27
27 0.26
28 0.27
29 0.24
30 0.19
31 0.16
32 0.13
33 0.13
34 0.12
35 0.11
36 0.09
37 0.09
38 0.07
39 0.11