Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UAH4

Protein Details
Accession A0A165UAH4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
62-83QAYRDCKKTWMDQKKEDRRAAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAADKAKDPSPRDNIRPKDYVETFKVFFALCLISPCENAAKASYDCLNRHDYDRDKCLDFFQAYRDCKKTWMDQKKEDRRAAYARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.66
4 0.61
5 0.6
6 0.56
7 0.54
8 0.48
9 0.45
10 0.39
11 0.36
12 0.34
13 0.25
14 0.21
15 0.16
16 0.12
17 0.08
18 0.09
19 0.11
20 0.1
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.11
30 0.14
31 0.16
32 0.16
33 0.19
34 0.22
35 0.2
36 0.22
37 0.27
38 0.3
39 0.31
40 0.35
41 0.35
42 0.34
43 0.33
44 0.32
45 0.31
46 0.26
47 0.22
48 0.24
49 0.29
50 0.31
51 0.36
52 0.38
53 0.34
54 0.36
55 0.4
56 0.43
57 0.46
58 0.54
59 0.56
60 0.63
61 0.74
62 0.81
63 0.86
64 0.83
65 0.75
66 0.71