Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TWC4

Protein Details
Accession A0A165TWC4   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-69RKHAPFKPKRTPKVTGQRRRQRQWYKDFLLHydrophilic
NLS Segment(s)
PositionSequence
40-59RKHAPFKPKRTPKVTGQRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 15.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences DDVILGYDWFKATEPDISWKRGIIRIEEIEDDEDIQQRMRKHAPFKPKRTPKVTGQRRRQRQWYKDFLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.24
3 0.27
4 0.29
5 0.29
6 0.3
7 0.31
8 0.31
9 0.31
10 0.24
11 0.26
12 0.25
13 0.26
14 0.25
15 0.23
16 0.2
17 0.18
18 0.16
19 0.11
20 0.1
21 0.09
22 0.09
23 0.11
24 0.11
25 0.15
26 0.19
27 0.23
28 0.28
29 0.34
30 0.45
31 0.53
32 0.61
33 0.68
34 0.74
35 0.78
36 0.79
37 0.78
38 0.77
39 0.78
40 0.8
41 0.8
42 0.81
43 0.83
44 0.87
45 0.9
46 0.9
47 0.9
48 0.89
49 0.88