Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164NCU7

Protein Details
Accession A0A164NCU7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30SEGSQKKSYSRPNSSKNKPKRITDPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences NSGVSEGSQKKSYSRPNSSKNKPKRITDPTLLWPCRINDCDKVFQREADLKRHQRTVVGHEMPGLCVLYYSILCRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.67
4 0.77
5 0.84
6 0.86
7 0.87
8 0.88
9 0.84
10 0.81
11 0.8
12 0.78
13 0.75
14 0.7
15 0.64
16 0.62
17 0.65
18 0.59
19 0.5
20 0.44
21 0.37
22 0.36
23 0.33
24 0.27
25 0.24
26 0.27
27 0.33
28 0.34
29 0.39
30 0.36
31 0.34
32 0.35
33 0.36
34 0.35
35 0.36
36 0.43
37 0.45
38 0.48
39 0.52
40 0.49
41 0.46
42 0.46
43 0.45
44 0.46
45 0.4
46 0.36
47 0.35
48 0.35
49 0.31
50 0.29
51 0.23
52 0.12
53 0.1
54 0.1
55 0.09
56 0.09