Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164WAV1

Protein Details
Accession A0A164WAV1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-39AVAARSREKKQLYRRWNRHLSKLRIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences QYTVRPFSEPELAAVAARSREKKQLYRRWNRHLSKLRIKIEHAFGMLKGRFPILRDIPATDLDNLYENIEALMVIHNILRVQGDDPSDIDGYNGEEEDEIVNDRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.19
5 0.22
6 0.22
7 0.29
8 0.35
9 0.43
10 0.52
11 0.59
12 0.66
13 0.74
14 0.81
15 0.83
16 0.88
17 0.83
18 0.83
19 0.83
20 0.81
21 0.8
22 0.8
23 0.75
24 0.68
25 0.66
26 0.6
27 0.53
28 0.46
29 0.36
30 0.27
31 0.22
32 0.25
33 0.22
34 0.18
35 0.15
36 0.14
37 0.13
38 0.14
39 0.19
40 0.14
41 0.17
42 0.16
43 0.17
44 0.18
45 0.19
46 0.19
47 0.15
48 0.13
49 0.11
50 0.12
51 0.11
52 0.1
53 0.08
54 0.07
55 0.06
56 0.06
57 0.05
58 0.04
59 0.05
60 0.04
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.11
72 0.12
73 0.15
74 0.15
75 0.14
76 0.13
77 0.11
78 0.11
79 0.11
80 0.11
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1