Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4TV81

Protein Details
Accession J4TV81    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-39FNKNNEKYRKYGKKKVDKADKKAAPBasic
NLS Segment(s)
PositionSequence
21-36KYRKYGKKKVDKADKK
Subcellular Location(s) mito 9, plas 7, nucl 4, cyto 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPRQRLANARFNKNNEKYRKYGKKKVDKADKKAAPMISRTWLGILIFLLVGGGVLQLISYIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.72
4 0.73
5 0.73
6 0.72
7 0.69
8 0.65
9 0.7
10 0.74
11 0.73
12 0.74
13 0.75
14 0.77
15 0.8
16 0.85
17 0.85
18 0.83
19 0.81
20 0.82
21 0.74
22 0.66
23 0.62
24 0.54
25 0.44
26 0.38
27 0.33
28 0.26
29 0.24
30 0.21
31 0.17
32 0.16
33 0.14
34 0.12
35 0.1
36 0.07
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02