Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164M6F0

Protein Details
Accession A0A164M6F0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPRDSANKNPRKPRKKKNIPVPLPDLDHydrophilic
NLS Segment(s)
PositionSequence
9-18KNPRKPRKKK
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAPRDSANKNPRKPRKKKNIPVPLPDLDDLLPIDPTVPLYEERPSVPPGLLQMDSAAPVYQENPVTPPSHAASARQSAGQQEQRLGRPPGPYRSWDEAERAEARQRLKQWSQHTQHVKPPYRMATGAKELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.93
4 0.94
5 0.94
6 0.95
7 0.92
8 0.89
9 0.85
10 0.77
11 0.69
12 0.59
13 0.49
14 0.38
15 0.31
16 0.23
17 0.16
18 0.13
19 0.08
20 0.08
21 0.07
22 0.07
23 0.06
24 0.07
25 0.08
26 0.09
27 0.11
28 0.12
29 0.13
30 0.15
31 0.16
32 0.16
33 0.15
34 0.14
35 0.13
36 0.15
37 0.14
38 0.11
39 0.11
40 0.1
41 0.1
42 0.1
43 0.08
44 0.05
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.1
53 0.1
54 0.12
55 0.11
56 0.14
57 0.14
58 0.14
59 0.16
60 0.18
61 0.18
62 0.17
63 0.16
64 0.15
65 0.21
66 0.23
67 0.21
68 0.22
69 0.25
70 0.26
71 0.31
72 0.32
73 0.29
74 0.31
75 0.35
76 0.38
77 0.37
78 0.38
79 0.4
80 0.44
81 0.45
82 0.4
83 0.39
84 0.34
85 0.36
86 0.35
87 0.3
88 0.29
89 0.29
90 0.3
91 0.33
92 0.35
93 0.39
94 0.43
95 0.48
96 0.51
97 0.58
98 0.61
99 0.65
100 0.7
101 0.67
102 0.68
103 0.72
104 0.71
105 0.65
106 0.67
107 0.63
108 0.58
109 0.56
110 0.53
111 0.5