Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W791

Protein Details
Accession G0W791   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
142-164SYCHWCKLFKRTGRKRHTLYWKVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 6, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ndi:NDAI_0B06210  -  
Amino Acid Sequences MPSSKSSLDTNAQGSAPQPVVPQRVPFVHRLYQYYQLCTSLLFTALLGRWLIIYPLAGSKFLPGGIHEFLCYLMVSSALGEIVWLFKFHKWNKAIFSRVMLKDLNFLYFVGVLHFYDDYEHALVLKNISYSCFIVGLSLNQSYCHWCKLFKRTGRKRHTLYWKVISLITLPFLYLSEFYLLLLNVNNVNFHSTPWLDLINKMVLIGYFPIALLAFKRQLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.17
5 0.17
6 0.2
7 0.25
8 0.27
9 0.29
10 0.28
11 0.33
12 0.35
13 0.38
14 0.39
15 0.39
16 0.4
17 0.42
18 0.42
19 0.46
20 0.46
21 0.45
22 0.4
23 0.35
24 0.32
25 0.27
26 0.25
27 0.16
28 0.15
29 0.11
30 0.09
31 0.11
32 0.11
33 0.12
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.06
40 0.06
41 0.06
42 0.09
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.08
51 0.11
52 0.12
53 0.13
54 0.12
55 0.11
56 0.11
57 0.11
58 0.1
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.06
73 0.08
74 0.17
75 0.19
76 0.27
77 0.28
78 0.31
79 0.36
80 0.4
81 0.41
82 0.34
83 0.36
84 0.35
85 0.33
86 0.33
87 0.28
88 0.22
89 0.23
90 0.22
91 0.19
92 0.12
93 0.12
94 0.1
95 0.1
96 0.09
97 0.06
98 0.07
99 0.06
100 0.06
101 0.06
102 0.05
103 0.06
104 0.06
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.07
116 0.09
117 0.08
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.09
127 0.09
128 0.1
129 0.14
130 0.15
131 0.18
132 0.16
133 0.19
134 0.25
135 0.33
136 0.42
137 0.45
138 0.56
139 0.62
140 0.72
141 0.78
142 0.81
143 0.77
144 0.78
145 0.81
146 0.77
147 0.74
148 0.7
149 0.63
150 0.56
151 0.51
152 0.42
153 0.33
154 0.25
155 0.2
156 0.13
157 0.1
158 0.09
159 0.09
160 0.09
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.1
167 0.09
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.1
174 0.1
175 0.14
176 0.14
177 0.14
178 0.18
179 0.16
180 0.17
181 0.18
182 0.22
183 0.18
184 0.19
185 0.22
186 0.19
187 0.18
188 0.17
189 0.16
190 0.12
191 0.13
192 0.13
193 0.1
194 0.08
195 0.08
196 0.09
197 0.08
198 0.09
199 0.09
200 0.13
201 0.17