Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165AG79

Protein Details
Accession A0A165AG79    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-82GEPSDQTQLKKRKRREKEKDKKAKKRKLAESNVVITBasic
NLS Segment(s)
PositionSequence
56-73KKRKRREKEKDKKAKKRK
Subcellular Location(s) cyto 13.5cyto_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MQHGGGDDLDDDFVPDDLVALSDGGEELDSASLESWTGVELDDQDGGEPSDQTQLKKRKRREKEKDKKAKKRKLAESNVVITPASVASQPPEALSEYLAQTHVKACPKLSSIELDELRIPAEWIADTSAWSTAPRTLDVLPEFIGKVLPSLKTRLGQRPKNPGAPTLLFITGAALRVVDVVRILKAMKGSNPKAGDIAKLFAKHVKIEEQVHYLKRTKVGAAAGTPGRIGKLINDTDALSLSALSHIILDTSYVDKKNRSMFEIPETRQEVFQLVLDTKPIRDALASGKTSLVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.06
11 0.05
12 0.05
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.15
38 0.17
39 0.19
40 0.28
41 0.37
42 0.47
43 0.56
44 0.66
45 0.69
46 0.79
47 0.88
48 0.9
49 0.92
50 0.93
51 0.95
52 0.96
53 0.96
54 0.96
55 0.96
56 0.95
57 0.93
58 0.92
59 0.91
60 0.91
61 0.89
62 0.86
63 0.81
64 0.75
65 0.66
66 0.56
67 0.45
68 0.34
69 0.25
70 0.16
71 0.11
72 0.07
73 0.06
74 0.07
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.1
82 0.11
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.11
89 0.14
90 0.17
91 0.17
92 0.17
93 0.19
94 0.21
95 0.22
96 0.21
97 0.2
98 0.19
99 0.24
100 0.23
101 0.21
102 0.2
103 0.18
104 0.18
105 0.14
106 0.12
107 0.06
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.06
117 0.07
118 0.07
119 0.08
120 0.09
121 0.09
122 0.11
123 0.11
124 0.13
125 0.14
126 0.14
127 0.12
128 0.11
129 0.11
130 0.09
131 0.09
132 0.06
133 0.06
134 0.07
135 0.08
136 0.09
137 0.11
138 0.13
139 0.16
140 0.2
141 0.29
142 0.37
143 0.42
144 0.47
145 0.55
146 0.57
147 0.61
148 0.58
149 0.5
150 0.46
151 0.4
152 0.35
153 0.27
154 0.23
155 0.16
156 0.15
157 0.14
158 0.1
159 0.09
160 0.08
161 0.05
162 0.05
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.09
173 0.1
174 0.14
175 0.22
176 0.24
177 0.3
178 0.31
179 0.3
180 0.31
181 0.3
182 0.28
183 0.21
184 0.21
185 0.17
186 0.17
187 0.17
188 0.18
189 0.19
190 0.18
191 0.19
192 0.2
193 0.22
194 0.25
195 0.27
196 0.29
197 0.32
198 0.34
199 0.36
200 0.36
201 0.34
202 0.34
203 0.33
204 0.28
205 0.27
206 0.26
207 0.24
208 0.21
209 0.24
210 0.21
211 0.2
212 0.19
213 0.16
214 0.14
215 0.12
216 0.11
217 0.09
218 0.15
219 0.16
220 0.17
221 0.18
222 0.18
223 0.18
224 0.19
225 0.17
226 0.1
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.1
239 0.14
240 0.17
241 0.19
242 0.22
243 0.27
244 0.34
245 0.36
246 0.38
247 0.39
248 0.39
249 0.47
250 0.53
251 0.5
252 0.5
253 0.51
254 0.46
255 0.42
256 0.4
257 0.32
258 0.24
259 0.24
260 0.19
261 0.16
262 0.16
263 0.19
264 0.19
265 0.18
266 0.2
267 0.18
268 0.16
269 0.15
270 0.16
271 0.2
272 0.27
273 0.28
274 0.26
275 0.26