Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164PIS1

Protein Details
Accession A0A164PIS1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAGSKSKKKANKNRDKNKEKAAQQKAAHydrophilic
NLS Segment(s)
PositionSequence
5-21KSKKKANKNRDKNKEKA
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAGSKSKKKANKNRDKNKEKAAQQKAASQSTGPGTGGNVDASTMELLQRLVTSVGTAGPSNIAQTNRVTRSTSKAKQKVVDSGDDDSETSSSGSSDESSEEEGLNLRDMGRLAPRTTDDDDHSSARSKRSHVDSDGEVLDDDDEDGPPSPTRRKITSAAQHGVVIGPRTEVIPRTNTSTRNSQLRSQRTGASSATTTPSTISGPITPAQRTPSPVGDGPPNLEFTPFKKNRFNDSRPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.9
4 0.89
5 0.87
6 0.84
7 0.83
8 0.81
9 0.78
10 0.72
11 0.71
12 0.67
13 0.61
14 0.53
15 0.43
16 0.37
17 0.31
18 0.3
19 0.23
20 0.17
21 0.14
22 0.15
23 0.15
24 0.12
25 0.09
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.07
45 0.08
46 0.08
47 0.09
48 0.12
49 0.12
50 0.12
51 0.15
52 0.22
53 0.23
54 0.25
55 0.26
56 0.25
57 0.32
58 0.4
59 0.45
60 0.49
61 0.53
62 0.56
63 0.58
64 0.59
65 0.59
66 0.52
67 0.49
68 0.41
69 0.36
70 0.32
71 0.27
72 0.24
73 0.17
74 0.14
75 0.1
76 0.08
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.09
98 0.11
99 0.11
100 0.12
101 0.13
102 0.16
103 0.18
104 0.18
105 0.17
106 0.19
107 0.21
108 0.2
109 0.2
110 0.2
111 0.2
112 0.22
113 0.22
114 0.21
115 0.24
116 0.28
117 0.31
118 0.29
119 0.31
120 0.28
121 0.28
122 0.27
123 0.22
124 0.16
125 0.13
126 0.11
127 0.07
128 0.07
129 0.05
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.1
136 0.13
137 0.19
138 0.23
139 0.26
140 0.29
141 0.33
142 0.41
143 0.47
144 0.51
145 0.47
146 0.44
147 0.41
148 0.37
149 0.33
150 0.26
151 0.18
152 0.1
153 0.08
154 0.08
155 0.08
156 0.09
157 0.11
158 0.12
159 0.15
160 0.16
161 0.23
162 0.27
163 0.3
164 0.32
165 0.38
166 0.4
167 0.45
168 0.47
169 0.47
170 0.52
171 0.56
172 0.58
173 0.53
174 0.53
175 0.46
176 0.46
177 0.4
178 0.33
179 0.28
180 0.23
181 0.24
182 0.19
183 0.18
184 0.16
185 0.16
186 0.14
187 0.14
188 0.14
189 0.12
190 0.14
191 0.17
192 0.2
193 0.2
194 0.21
195 0.26
196 0.27
197 0.3
198 0.32
199 0.33
200 0.34
201 0.34
202 0.35
203 0.36
204 0.35
205 0.34
206 0.31
207 0.31
208 0.26
209 0.27
210 0.25
211 0.23
212 0.32
213 0.34
214 0.39
215 0.45
216 0.49
217 0.57
218 0.66