Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165AG62

Protein Details
Accession A0A165AG62    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LWKIPWKLSRTRKTNQRKRLKLVDNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFPTSVNLGGLLWKIPWKLSRTRKTNQRKRLKLVDNVIETVRASGVECASLAKALELPKESEMPARDKYTVFSPHVEGYRKGIHKVPKFTRVRPSSTLFCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.2
4 0.22
5 0.32
6 0.42
7 0.51
8 0.55
9 0.63
10 0.71
11 0.78
12 0.84
13 0.85
14 0.85
15 0.83
16 0.84
17 0.86
18 0.82
19 0.78
20 0.74
21 0.71
22 0.62
23 0.55
24 0.47
25 0.37
26 0.3
27 0.23
28 0.16
29 0.08
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.11
46 0.13
47 0.13
48 0.14
49 0.16
50 0.18
51 0.21
52 0.22
53 0.22
54 0.22
55 0.23
56 0.25
57 0.28
58 0.26
59 0.25
60 0.25
61 0.27
62 0.32
63 0.33
64 0.28
65 0.28
66 0.34
67 0.34
68 0.34
69 0.37
70 0.42
71 0.46
72 0.56
73 0.58
74 0.6
75 0.64
76 0.68
77 0.73
78 0.69
79 0.68
80 0.63
81 0.63