Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164QC71

Protein Details
Accession A0A164QC71    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-54ETSARRTRCRSGRWSRHCNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 7, cyto 4, extr 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences IARLRPDFMDGPHISEGEWGLGLMEGKGQGQYNQETSARRTRCRSGRWSRHCNVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.11
5 0.11
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.05
15 0.05
16 0.06
17 0.09
18 0.1
19 0.11
20 0.13
21 0.16
22 0.17
23 0.21
24 0.29
25 0.31
26 0.34
27 0.39
28 0.45
29 0.52
30 0.58
31 0.64
32 0.66
33 0.73
34 0.79
35 0.83