Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164ZV07

Protein Details
Accession A0A164ZV07    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-93PDPLKERKEENKRPRRGNVABasic
NLS Segment(s)
PositionSequence
80-89RKEENKRPRR
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MWKMQETSQKNLKLWTGKTPSACQPSTRTRLTTGEPTKLDLYPSDASHRRPGPTMRGRSPVVIHTTPTKYRFAPDPLKERKEENKRPRRGNVAPTQLSSPGMVDQAPFYVHHSAARFREDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.47
4 0.46
5 0.49
6 0.5
7 0.52
8 0.52
9 0.5
10 0.44
11 0.43
12 0.48
13 0.51
14 0.49
15 0.43
16 0.39
17 0.42
18 0.43
19 0.46
20 0.41
21 0.41
22 0.38
23 0.39
24 0.38
25 0.35
26 0.31
27 0.22
28 0.23
29 0.18
30 0.19
31 0.22
32 0.23
33 0.25
34 0.31
35 0.33
36 0.29
37 0.3
38 0.32
39 0.35
40 0.41
41 0.45
42 0.41
43 0.44
44 0.43
45 0.42
46 0.4
47 0.33
48 0.3
49 0.24
50 0.21
51 0.21
52 0.24
53 0.26
54 0.27
55 0.27
56 0.22
57 0.23
58 0.26
59 0.29
60 0.34
61 0.36
62 0.44
63 0.49
64 0.53
65 0.52
66 0.53
67 0.56
68 0.58
69 0.64
70 0.65
71 0.68
72 0.73
73 0.79
74 0.8
75 0.79
76 0.75
77 0.73
78 0.71
79 0.71
80 0.64
81 0.58
82 0.54
83 0.46
84 0.41
85 0.32
86 0.23
87 0.15
88 0.13
89 0.11
90 0.1
91 0.09
92 0.1
93 0.1
94 0.1
95 0.12
96 0.15
97 0.15
98 0.19
99 0.21
100 0.27
101 0.29