Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6ECK3

Protein Details
Accession J6ECK3   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MASLPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
8-24KIVKKHTKKFKRHHSDR
Subcellular Location(s) nucl 11.5mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISQPKIGYGSNNKTKFLSPSGHKIFLVANVKDLETLTMHTKTYAAEIAHNISAKNRVVILARAKALGVKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.91
4 0.92
5 0.92
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.91
12 0.86
13 0.76
14 0.71
15 0.71
16 0.71
17 0.71
18 0.7
19 0.64
20 0.59
21 0.58
22 0.61
23 0.57
24 0.53
25 0.5
26 0.49
27 0.56
28 0.64
29 0.67
30 0.6
31 0.56
32 0.52
33 0.48
34 0.49
35 0.5
36 0.51
37 0.52
38 0.56
39 0.54
40 0.52
41 0.49
42 0.39
43 0.32
44 0.28
45 0.3
46 0.34
47 0.35
48 0.34
49 0.34
50 0.35
51 0.33
52 0.3
53 0.27
54 0.21
55 0.29
56 0.32
57 0.32
58 0.31
59 0.3
60 0.27
61 0.28
62 0.31
63 0.22
64 0.2
65 0.19
66 0.19
67 0.19
68 0.18
69 0.13
70 0.08
71 0.1
72 0.11
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.14
80 0.11
81 0.12
82 0.13
83 0.16
84 0.17
85 0.18
86 0.16
87 0.15
88 0.19
89 0.18
90 0.17
91 0.15
92 0.15
93 0.16
94 0.21
95 0.26
96 0.26
97 0.26
98 0.25
99 0.25
100 0.25
101 0.24
102 0.24
103 0.19
104 0.2
105 0.28
106 0.36
107 0.42
108 0.41
109 0.43
110 0.42