Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5PDM2

Protein Details
Accession J5PDM2    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-37ADAPDKEPVKKQKPNHRRNTDNKNINNKGSHydrophilic
63-84KTKNKIKETPIKQKNRTRSQGKHydrophilic
NLS Segment(s)
PositionSequence
17-79KKQKPNHRRNTDNKNINNKGSGEGKSNNRRKDTENKVNSNRRNGENKTKNKIKETPIKQKNRT
113-135KNRPAKTKSKSDSPSKMKLLKKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR020401  mRNA_transport_factor_GFD1  
Pfam View protein in Pfam  
PF17331  GFD1  
Amino Acid Sequences MPLESIWADAPDKEPVKKQKPNHRRNTDNKNINNKGSGEGKSNNRRKDTENKVNSNRRNGENKTKNKIKETPIKQKNRTRSQGKISPVTDPLAINPFSQKITEVSPPPISPSKNRPAKTKSKSDSPSKMKLLKKKIEEQREILQKTHHNKQQQQVLMDFLNDEGNSNWVDDDEEELILQRLKTSLKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.51
4 0.59
5 0.66
6 0.69
7 0.77
8 0.85
9 0.88
10 0.88
11 0.88
12 0.9
13 0.91
14 0.9
15 0.89
16 0.87
17 0.86
18 0.81
19 0.74
20 0.68
21 0.58
22 0.51
23 0.46
24 0.39
25 0.33
26 0.34
27 0.41
28 0.48
29 0.55
30 0.57
31 0.57
32 0.58
33 0.59
34 0.63
35 0.64
36 0.64
37 0.65
38 0.68
39 0.73
40 0.79
41 0.79
42 0.78
43 0.73
44 0.68
45 0.67
46 0.63
47 0.65
48 0.65
49 0.68
50 0.68
51 0.71
52 0.69
53 0.67
54 0.68
55 0.64
56 0.64
57 0.65
58 0.67
59 0.69
60 0.75
61 0.77
62 0.78
63 0.81
64 0.8
65 0.8
66 0.75
67 0.71
68 0.69
69 0.67
70 0.63
71 0.6
72 0.51
73 0.44
74 0.4
75 0.35
76 0.27
77 0.21
78 0.18
79 0.14
80 0.14
81 0.12
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.09
88 0.1
89 0.14
90 0.15
91 0.17
92 0.18
93 0.18
94 0.2
95 0.23
96 0.22
97 0.23
98 0.29
99 0.36
100 0.43
101 0.45
102 0.49
103 0.53
104 0.62
105 0.64
106 0.67
107 0.61
108 0.63
109 0.67
110 0.68
111 0.71
112 0.67
113 0.68
114 0.64
115 0.68
116 0.64
117 0.67
118 0.68
119 0.66
120 0.65
121 0.67
122 0.7
123 0.72
124 0.71
125 0.67
126 0.66
127 0.67
128 0.63
129 0.54
130 0.5
131 0.48
132 0.5
133 0.54
134 0.52
135 0.51
136 0.55
137 0.61
138 0.65
139 0.62
140 0.58
141 0.5
142 0.48
143 0.4
144 0.34
145 0.26
146 0.18
147 0.16
148 0.13
149 0.13
150 0.1
151 0.11
152 0.11
153 0.11
154 0.1
155 0.08
156 0.1
157 0.09
158 0.12
159 0.11
160 0.11
161 0.11
162 0.11
163 0.13
164 0.14
165 0.13
166 0.11
167 0.12