Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164YTC1

Protein Details
Accession A0A164YTC1   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-121IPSPPSSNLNSRKKRKRHEEDEQDYEDHydrophilic
NLS Segment(s)
PositionSequence
106-111RKKRKR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039772  Bin3-like  
IPR010675  Bin3_C  
IPR024160  BIN3_SAM-bd_dom  
IPR025714  Methyltranfer_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008171  F:O-methyltransferase activity  
GO:0008173  F:RNA methyltransferase activity  
Pfam View protein in Pfam  
PF06859  Bin3  
PF13847  Methyltransf_31  
PROSITE View protein in PROSITE  
PS51515  BIN3_SAM  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSAPIHGNYHGYYIKRPSTHDPRLALLPPSFFANKHVLDIGCNEGWVTCEIAQTRRAAKVVGVDIDETLIRAAWKRRRSVWSAQRPHSSTSESQIPSPPSSNLNSRKKRKRHEEDEQDYEDSSNSGFDSGSGPSSVANYFPASLEHTFGPIPIPPSSSSSSASQTEFPHNILFRTCDWVKEGAFEDKSGYDIVLAFSITKWIHLHGGDEGLLAFFRRVHNVLRRDGKFVLEPQPWEGYTKARKMSPLLQENAKTLKLRPDDFAQALRDIGFSEPQKLGSVGEGGFHRPVDVYTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.43
4 0.48
5 0.54
6 0.61
7 0.63
8 0.59
9 0.55
10 0.58
11 0.55
12 0.5
13 0.41
14 0.34
15 0.28
16 0.3
17 0.27
18 0.23
19 0.24
20 0.26
21 0.24
22 0.25
23 0.27
24 0.23
25 0.23
26 0.25
27 0.26
28 0.2
29 0.19
30 0.17
31 0.13
32 0.15
33 0.14
34 0.14
35 0.1
36 0.13
37 0.15
38 0.17
39 0.2
40 0.23
41 0.25
42 0.25
43 0.25
44 0.23
45 0.22
46 0.25
47 0.25
48 0.23
49 0.2
50 0.18
51 0.17
52 0.17
53 0.16
54 0.11
55 0.08
56 0.06
57 0.06
58 0.09
59 0.17
60 0.24
61 0.31
62 0.35
63 0.42
64 0.48
65 0.54
66 0.61
67 0.64
68 0.67
69 0.7
70 0.72
71 0.73
72 0.69
73 0.66
74 0.58
75 0.51
76 0.42
77 0.37
78 0.39
79 0.32
80 0.31
81 0.32
82 0.32
83 0.29
84 0.3
85 0.27
86 0.21
87 0.23
88 0.3
89 0.36
90 0.44
91 0.52
92 0.6
93 0.69
94 0.75
95 0.83
96 0.86
97 0.86
98 0.85
99 0.86
100 0.87
101 0.84
102 0.81
103 0.74
104 0.63
105 0.53
106 0.44
107 0.33
108 0.22
109 0.15
110 0.08
111 0.05
112 0.05
113 0.04
114 0.05
115 0.06
116 0.06
117 0.07
118 0.07
119 0.07
120 0.06
121 0.07
122 0.07
123 0.06
124 0.07
125 0.06
126 0.07
127 0.07
128 0.07
129 0.09
130 0.09
131 0.11
132 0.09
133 0.1
134 0.1
135 0.1
136 0.1
137 0.08
138 0.1
139 0.09
140 0.1
141 0.1
142 0.14
143 0.16
144 0.17
145 0.18
146 0.17
147 0.2
148 0.2
149 0.2
150 0.19
151 0.19
152 0.21
153 0.2
154 0.19
155 0.19
156 0.18
157 0.18
158 0.16
159 0.16
160 0.13
161 0.19
162 0.18
163 0.16
164 0.18
165 0.19
166 0.19
167 0.19
168 0.21
169 0.19
170 0.19
171 0.18
172 0.17
173 0.15
174 0.16
175 0.14
176 0.11
177 0.07
178 0.07
179 0.07
180 0.06
181 0.06
182 0.05
183 0.05
184 0.09
185 0.08
186 0.1
187 0.1
188 0.1
189 0.13
190 0.13
191 0.14
192 0.11
193 0.13
194 0.11
195 0.11
196 0.1
197 0.07
198 0.07
199 0.06
200 0.06
201 0.06
202 0.07
203 0.1
204 0.12
205 0.18
206 0.27
207 0.31
208 0.39
209 0.47
210 0.48
211 0.49
212 0.48
213 0.45
214 0.39
215 0.39
216 0.38
217 0.32
218 0.32
219 0.3
220 0.33
221 0.3
222 0.3
223 0.27
224 0.27
225 0.3
226 0.35
227 0.36
228 0.35
229 0.37
230 0.4
231 0.47
232 0.48
233 0.49
234 0.48
235 0.49
236 0.49
237 0.5
238 0.49
239 0.45
240 0.36
241 0.31
242 0.35
243 0.36
244 0.36
245 0.36
246 0.38
247 0.41
248 0.42
249 0.44
250 0.38
251 0.33
252 0.31
253 0.28
254 0.23
255 0.17
256 0.16
257 0.18
258 0.17
259 0.2
260 0.21
261 0.21
262 0.23
263 0.22
264 0.21
265 0.17
266 0.18
267 0.14
268 0.16
269 0.16
270 0.18
271 0.19
272 0.18
273 0.17
274 0.15
275 0.16