Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164U865

Protein Details
Accession A0A164U865   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MSIKIVKKRTKVFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-50KKRTKVFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 11.5mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSIKIVKKRTKVFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDILLMHNKSFAAEIAHGVSSRNRILILERAKALGVSVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.88
4 0.86
5 0.83
6 0.81
7 0.78
8 0.7
9 0.61
10 0.56
11 0.54
12 0.54
13 0.57
14 0.57
15 0.52
16 0.5
17 0.5
18 0.55
19 0.59
20 0.6
21 0.6
22 0.61
23 0.7
24 0.79
25 0.83
26 0.76
27 0.74
28 0.71
29 0.68
30 0.68
31 0.64
32 0.64
33 0.64
34 0.66
35 0.59
36 0.52
37 0.46
38 0.38
39 0.38
40 0.33
41 0.35
42 0.4
43 0.42
44 0.42
45 0.46
46 0.47
47 0.47
48 0.46
49 0.47
50 0.45
51 0.54
52 0.54
53 0.52
54 0.48
55 0.4
56 0.37
57 0.34
58 0.33
59 0.24
60 0.26
61 0.26
62 0.27
63 0.27
64 0.25
65 0.19
66 0.13
67 0.13
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.08
77 0.07
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.13
84 0.14
85 0.14
86 0.14
87 0.12
88 0.13
89 0.16
90 0.23
91 0.26
92 0.27
93 0.27
94 0.27
95 0.27
96 0.26
97 0.23
98 0.17
99 0.13
100 0.11
101 0.13
102 0.15
103 0.15
104 0.16
105 0.17
106 0.17