Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164Z488

Protein Details
Accession A0A164Z488    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-197PEPVLKPKVAAKKRKRSETTEHydrophilic
499-531ASGANGKVKTKKSKKDKDKKGERDKEKDKSGGKBasic
NLS Segment(s)
PositionSequence
173-193KVEKPEPVLKPKVAAKKRKRS
318-329RTAGKKKEKGGA
502-530ANGKVKTKKSKKDKDKKGERDKEKDKSGG
Subcellular Location(s) cyto 16.5, cyto_nucl 12.833, nucl 8, mito_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000253  FHA_dom  
IPR001766  Fork_head_dom  
IPR008984  SMAD_FHA_dom_sf  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0045893  P:positive regulation of DNA-templated transcription  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00498  FHA  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50006  FHA_DOMAIN  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
cd22701  FHA_FKH1-like  
Amino Acid Sequences MSGSNGNSVTSDDKISAYYSLAFPNFTYYLQTLNVSIGRRPIPSSNPSTSAPIDPSQIVDVDLGPLKSVSRLHARIEYEEDEERFVLVVLGRNGAWVDGVWAASGSMVPLSARSQIQIASRTFHFVLPPPPEDSVAPSSPSSEGRVRSPSVDITSVSPESAPPSPSPPPPPVKVEKPEPVLKPKVAAKKRKRSETTESAPAAPKAVAAKSLPTKPDPPVEMPLKPSLTYSVLCYRAIKALGGRGTLQEICTWMMENFLWYKLNEGSGWEGSVRHNLSSNKAFCKSKAKSEDRGKGYYWNINKECEHLFDESSGKAVGRTAGKKKEKGGAPLSEPPLKRSVAQSRAPLPPPLTNVPLPTPAATPTPPSLPPTSHSNAPPANPPIANPSKPPAPTAGVASKSPAQNQSSDTQIPASVKLPILVKALPPDHPAVLAASKSTSTPAGLEVPPMVLDAGTLILSPVIFSSLTPEQIKELEELGAKKAIEVLQAHLVRFLKEKMASGANGKVKTKKSKKDKDKKGERDKEKDKSGGKDANAASGTATPTAATAVATSGPSVCEVPRKVDSAFTSPFPLPPGAAAAMAAEHNDEPAFKKRKVEIDVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.14
5 0.15
6 0.15
7 0.19
8 0.19
9 0.19
10 0.18
11 0.22
12 0.22
13 0.2
14 0.23
15 0.19
16 0.21
17 0.21
18 0.22
19 0.17
20 0.19
21 0.23
22 0.2
23 0.21
24 0.24
25 0.26
26 0.26
27 0.29
28 0.32
29 0.35
30 0.4
31 0.46
32 0.45
33 0.46
34 0.47
35 0.48
36 0.45
37 0.41
38 0.38
39 0.32
40 0.3
41 0.26
42 0.26
43 0.22
44 0.2
45 0.18
46 0.14
47 0.13
48 0.13
49 0.15
50 0.13
51 0.12
52 0.12
53 0.12
54 0.14
55 0.15
56 0.17
57 0.24
58 0.27
59 0.3
60 0.36
61 0.38
62 0.38
63 0.42
64 0.4
65 0.35
66 0.36
67 0.33
68 0.28
69 0.26
70 0.23
71 0.18
72 0.15
73 0.12
74 0.1
75 0.14
76 0.13
77 0.14
78 0.14
79 0.14
80 0.14
81 0.13
82 0.11
83 0.07
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.07
98 0.11
99 0.11
100 0.11
101 0.12
102 0.15
103 0.19
104 0.23
105 0.23
106 0.23
107 0.24
108 0.28
109 0.28
110 0.26
111 0.24
112 0.22
113 0.28
114 0.29
115 0.31
116 0.29
117 0.29
118 0.29
119 0.28
120 0.29
121 0.27
122 0.24
123 0.23
124 0.21
125 0.21
126 0.22
127 0.22
128 0.22
129 0.21
130 0.22
131 0.23
132 0.28
133 0.28
134 0.28
135 0.29
136 0.27
137 0.25
138 0.24
139 0.22
140 0.19
141 0.22
142 0.2
143 0.18
144 0.16
145 0.13
146 0.15
147 0.17
148 0.16
149 0.13
150 0.18
151 0.22
152 0.26
153 0.3
154 0.34
155 0.38
156 0.39
157 0.44
158 0.46
159 0.5
160 0.51
161 0.54
162 0.53
163 0.53
164 0.56
165 0.54
166 0.56
167 0.53
168 0.48
169 0.45
170 0.45
171 0.5
172 0.52
173 0.59
174 0.61
175 0.68
176 0.76
177 0.82
178 0.8
179 0.78
180 0.78
181 0.77
182 0.72
183 0.69
184 0.62
185 0.54
186 0.5
187 0.43
188 0.35
189 0.25
190 0.21
191 0.14
192 0.13
193 0.13
194 0.11
195 0.15
196 0.19
197 0.22
198 0.23
199 0.24
200 0.27
201 0.27
202 0.32
203 0.31
204 0.29
205 0.32
206 0.33
207 0.32
208 0.32
209 0.33
210 0.3
211 0.27
212 0.24
213 0.2
214 0.19
215 0.18
216 0.18
217 0.2
218 0.21
219 0.21
220 0.22
221 0.2
222 0.21
223 0.21
224 0.18
225 0.13
226 0.15
227 0.16
228 0.16
229 0.15
230 0.13
231 0.15
232 0.15
233 0.14
234 0.1
235 0.1
236 0.1
237 0.09
238 0.1
239 0.07
240 0.08
241 0.08
242 0.08
243 0.08
244 0.09
245 0.1
246 0.09
247 0.11
248 0.1
249 0.11
250 0.1
251 0.1
252 0.12
253 0.11
254 0.11
255 0.09
256 0.1
257 0.09
258 0.14
259 0.14
260 0.12
261 0.16
262 0.16
263 0.2
264 0.26
265 0.28
266 0.27
267 0.31
268 0.31
269 0.29
270 0.38
271 0.36
272 0.38
273 0.45
274 0.47
275 0.52
276 0.6
277 0.67
278 0.61
279 0.62
280 0.54
281 0.49
282 0.46
283 0.43
284 0.36
285 0.36
286 0.33
287 0.33
288 0.32
289 0.3
290 0.28
291 0.25
292 0.24
293 0.17
294 0.16
295 0.14
296 0.15
297 0.13
298 0.12
299 0.1
300 0.08
301 0.07
302 0.07
303 0.08
304 0.11
305 0.16
306 0.22
307 0.31
308 0.36
309 0.39
310 0.41
311 0.46
312 0.45
313 0.46
314 0.45
315 0.39
316 0.38
317 0.41
318 0.42
319 0.4
320 0.37
321 0.33
322 0.31
323 0.28
324 0.25
325 0.26
326 0.3
327 0.32
328 0.36
329 0.37
330 0.39
331 0.43
332 0.44
333 0.4
334 0.34
335 0.29
336 0.3
337 0.28
338 0.27
339 0.23
340 0.23
341 0.22
342 0.22
343 0.21
344 0.17
345 0.15
346 0.13
347 0.15
348 0.13
349 0.14
350 0.13
351 0.16
352 0.16
353 0.18
354 0.18
355 0.17
356 0.2
357 0.24
358 0.26
359 0.27
360 0.27
361 0.29
362 0.29
363 0.29
364 0.32
365 0.27
366 0.27
367 0.23
368 0.23
369 0.26
370 0.29
371 0.29
372 0.26
373 0.27
374 0.3
375 0.3
376 0.31
377 0.26
378 0.23
379 0.23
380 0.25
381 0.26
382 0.23
383 0.22
384 0.23
385 0.25
386 0.23
387 0.25
388 0.25
389 0.22
390 0.22
391 0.25
392 0.25
393 0.25
394 0.24
395 0.22
396 0.18
397 0.18
398 0.17
399 0.16
400 0.15
401 0.13
402 0.12
403 0.14
404 0.15
405 0.15
406 0.16
407 0.15
408 0.15
409 0.18
410 0.19
411 0.19
412 0.2
413 0.2
414 0.18
415 0.18
416 0.17
417 0.14
418 0.14
419 0.12
420 0.1
421 0.09
422 0.09
423 0.09
424 0.1
425 0.09
426 0.08
427 0.08
428 0.1
429 0.13
430 0.13
431 0.13
432 0.12
433 0.12
434 0.12
435 0.11
436 0.1
437 0.05
438 0.05
439 0.04
440 0.05
441 0.04
442 0.04
443 0.04
444 0.04
445 0.04
446 0.04
447 0.04
448 0.05
449 0.05
450 0.05
451 0.1
452 0.12
453 0.16
454 0.17
455 0.17
456 0.18
457 0.19
458 0.2
459 0.16
460 0.15
461 0.13
462 0.15
463 0.16
464 0.17
465 0.19
466 0.17
467 0.16
468 0.18
469 0.17
470 0.18
471 0.18
472 0.19
473 0.24
474 0.26
475 0.26
476 0.27
477 0.27
478 0.25
479 0.27
480 0.25
481 0.22
482 0.22
483 0.23
484 0.23
485 0.25
486 0.25
487 0.26
488 0.32
489 0.32
490 0.35
491 0.37
492 0.4
493 0.44
494 0.54
495 0.61
496 0.64
497 0.69
498 0.76
499 0.85
500 0.89
501 0.93
502 0.93
503 0.94
504 0.95
505 0.95
506 0.95
507 0.93
508 0.93
509 0.91
510 0.89
511 0.85
512 0.82
513 0.76
514 0.71
515 0.7
516 0.66
517 0.57
518 0.57
519 0.5
520 0.48
521 0.43
522 0.36
523 0.29
524 0.24
525 0.25
526 0.17
527 0.17
528 0.1
529 0.1
530 0.1
531 0.1
532 0.07
533 0.06
534 0.07
535 0.08
536 0.08
537 0.08
538 0.08
539 0.09
540 0.1
541 0.11
542 0.11
543 0.18
544 0.2
545 0.25
546 0.28
547 0.31
548 0.3
549 0.35
550 0.38
551 0.36
552 0.38
553 0.34
554 0.35
555 0.33
556 0.34
557 0.31
558 0.28
559 0.21
560 0.19
561 0.2
562 0.16
563 0.15
564 0.14
565 0.11
566 0.11
567 0.11
568 0.11
569 0.09
570 0.08
571 0.09
572 0.09
573 0.1
574 0.13
575 0.23
576 0.3
577 0.3
578 0.38
579 0.44
580 0.52
581 0.57