Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164WR75

Protein Details
Accession A0A164WR75   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-127KGADGDGKKRKRTRGKAKAKKEETEEERBasic
NLS Segment(s)
PositionSequence
105-120DGKKRKRTRGKAKAKK
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKNKNKQTKFPVARIKKIMQKDEEVGKVAQATPVVISKALELFLQHVVEASSSVTKSRGAKRVEPYHLKHAIHTTEMLDFLKEIVENVPDPTNGGAIPEKGADGDGKKRKRTRGKAKAKKEETEEERTDEGDEQEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.72
4 0.72
5 0.7
6 0.63
7 0.6
8 0.56
9 0.56
10 0.51
11 0.46
12 0.38
13 0.31
14 0.27
15 0.23
16 0.19
17 0.13
18 0.11
19 0.09
20 0.11
21 0.11
22 0.1
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.07
29 0.08
30 0.1
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.1
43 0.15
44 0.21
45 0.28
46 0.3
47 0.35
48 0.43
49 0.5
50 0.54
51 0.56
52 0.53
53 0.54
54 0.56
55 0.5
56 0.43
57 0.39
58 0.33
59 0.27
60 0.25
61 0.17
62 0.12
63 0.13
64 0.12
65 0.08
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.08
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.2
92 0.28
93 0.35
94 0.43
95 0.5
96 0.59
97 0.69
98 0.77
99 0.79
100 0.81
101 0.86
102 0.88
103 0.93
104 0.94
105 0.9
106 0.86
107 0.81
108 0.8
109 0.75
110 0.73
111 0.65
112 0.58
113 0.52
114 0.46
115 0.41
116 0.33
117 0.28