Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164TED4

Protein Details
Accession A0A164TED4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-85LNFEDDHRKRRRNRTTQSCWSCHAAKRKCDRKRPCTRCIQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLDHILSASPTQQLASSPTAIPNPPNPFDFPSNTKVESDSGDLVLNFEDDHRKRRRNRTTQSCWSCHAAKRKCDRKRPCTRCIQLGLTGLCVYETDDPSTRDDPSLSETQRLRARVAELESLVRELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.17
5 0.19
6 0.21
7 0.21
8 0.23
9 0.26
10 0.3
11 0.3
12 0.31
13 0.32
14 0.34
15 0.36
16 0.38
17 0.36
18 0.35
19 0.36
20 0.35
21 0.32
22 0.29
23 0.27
24 0.24
25 0.21
26 0.17
27 0.14
28 0.14
29 0.13
30 0.12
31 0.11
32 0.09
33 0.06
34 0.06
35 0.13
36 0.14
37 0.22
38 0.29
39 0.37
40 0.45
41 0.56
42 0.66
43 0.69
44 0.78
45 0.81
46 0.83
47 0.86
48 0.84
49 0.76
50 0.67
51 0.61
52 0.53
53 0.47
54 0.48
55 0.44
56 0.45
57 0.53
58 0.61
59 0.66
60 0.73
61 0.79
62 0.8
63 0.85
64 0.84
65 0.82
66 0.83
67 0.78
68 0.74
69 0.69
70 0.61
71 0.53
72 0.49
73 0.42
74 0.32
75 0.28
76 0.21
77 0.16
78 0.13
79 0.11
80 0.11
81 0.12
82 0.13
83 0.16
84 0.17
85 0.22
86 0.23
87 0.22
88 0.2
89 0.19
90 0.17
91 0.21
92 0.27
93 0.24
94 0.29
95 0.29
96 0.35
97 0.4
98 0.41
99 0.37
100 0.32
101 0.34
102 0.33
103 0.35
104 0.32
105 0.28
106 0.29
107 0.28