Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164VL78

Protein Details
Accession A0A164VL78    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-118ESTKTPKAPKAPKPSKSSRSTHydrophilic
NLS Segment(s)
PositionSequence
104-114KAPKAPKPSKS
Subcellular Location(s) mito 18.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSPASSTTHLVSSSAKKDYFSAFATLSSKYGASGSAPSHSTKSSKKSSTSSSMKSTSSTVSTTSTPSSGARDYEAAFASLASSYGANGHAPTVPTFESTKTPKAPKAPKPSKSSRSTPAPPTKESGFGWGPNVSMFRTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.29
4 0.28
5 0.3
6 0.32
7 0.31
8 0.27
9 0.25
10 0.2
11 0.22
12 0.23
13 0.21
14 0.19
15 0.16
16 0.14
17 0.11
18 0.11
19 0.09
20 0.09
21 0.11
22 0.11
23 0.13
24 0.14
25 0.15
26 0.17
27 0.18
28 0.21
29 0.23
30 0.29
31 0.34
32 0.37
33 0.4
34 0.42
35 0.46
36 0.5
37 0.52
38 0.49
39 0.46
40 0.45
41 0.41
42 0.38
43 0.34
44 0.26
45 0.22
46 0.18
47 0.14
48 0.14
49 0.14
50 0.14
51 0.13
52 0.12
53 0.11
54 0.11
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.11
61 0.12
62 0.11
63 0.1
64 0.09
65 0.08
66 0.08
67 0.06
68 0.06
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.09
82 0.11
83 0.12
84 0.13
85 0.17
86 0.21
87 0.26
88 0.3
89 0.34
90 0.36
91 0.45
92 0.53
93 0.57
94 0.65
95 0.69
96 0.71
97 0.76
98 0.81
99 0.81
100 0.78
101 0.75
102 0.72
103 0.71
104 0.69
105 0.71
106 0.71
107 0.67
108 0.63
109 0.61
110 0.56
111 0.51
112 0.45
113 0.42
114 0.35
115 0.31
116 0.32
117 0.28
118 0.26
119 0.23
120 0.24
121 0.18