Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164VSH5

Protein Details
Accession A0A164VSH5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-47TSDTCHYKKRRNLSSGNSVYHydrophilic
NLS Segment(s)
PositionSequence
361-376APSSRPIPRPSPAPAP
380-384GRLRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSLDQNLFTLNFVNADPNDSMSLDLVDTSDTCHYKKRRNLSSGNSVYSWYLLEPPGDAVLATVTAPNATAKTKTIQLYNPSVTLEIKYAGTLSFRWVFSWEDHEFEWRREQCFLIRKPDPPVLVAVTKEPPGKIKTSTLQILDYNLHRFDINDRKGLEVVLLAALLSFQDQSDDRSGSSSKPAESPTTVSPGPAVPAPKYETIPEQVATLQKKEAIVRNEVVVGEVGEVSDYVPFCTKLLMDREIVFIVLRSTTPSTVPKVVSVAEQTKLEMHRGEMLSEDLHQYVSYDDVPTPQVGGKGKKIIKLDDDGKEKDKSSTYKPPTRLLLRLSKVVIPELEPRNPPSRVSSHGSHRPPQGPPPAPSSRPIPRPSPAPAPNSTGRLRKDPPAPALNSKPPSLAPPPLPDRRTRPHSFHGAPAFPNAVPSGNAYFMPPPGAPPPPGAPPPFGAPPPGGPPPQFYGSPPPMHPAWQPPPPPMMSPPPGNYPPMGPPQPHNHSLQDHLKESAMNLLGGLGQFIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.19
4 0.19
5 0.2
6 0.19
7 0.19
8 0.14
9 0.15
10 0.11
11 0.11
12 0.09
13 0.08
14 0.08
15 0.1
16 0.15
17 0.17
18 0.18
19 0.27
20 0.34
21 0.43
22 0.52
23 0.6
24 0.64
25 0.71
26 0.78
27 0.78
28 0.81
29 0.78
30 0.73
31 0.63
32 0.54
33 0.46
34 0.38
35 0.3
36 0.2
37 0.16
38 0.13
39 0.13
40 0.12
41 0.13
42 0.13
43 0.12
44 0.11
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.09
55 0.1
56 0.12
57 0.13
58 0.16
59 0.22
60 0.25
61 0.28
62 0.32
63 0.36
64 0.42
65 0.42
66 0.4
67 0.35
68 0.34
69 0.3
70 0.26
71 0.21
72 0.15
73 0.13
74 0.12
75 0.12
76 0.11
77 0.11
78 0.11
79 0.14
80 0.17
81 0.17
82 0.18
83 0.19
84 0.21
85 0.21
86 0.28
87 0.24
88 0.21
89 0.22
90 0.28
91 0.28
92 0.29
93 0.37
94 0.33
95 0.34
96 0.33
97 0.34
98 0.34
99 0.42
100 0.45
101 0.45
102 0.45
103 0.47
104 0.51
105 0.54
106 0.48
107 0.39
108 0.37
109 0.31
110 0.28
111 0.26
112 0.23
113 0.2
114 0.23
115 0.23
116 0.21
117 0.22
118 0.23
119 0.25
120 0.25
121 0.28
122 0.29
123 0.32
124 0.36
125 0.33
126 0.32
127 0.3
128 0.29
129 0.27
130 0.26
131 0.23
132 0.2
133 0.19
134 0.16
135 0.16
136 0.21
137 0.29
138 0.29
139 0.31
140 0.31
141 0.32
142 0.32
143 0.32
144 0.25
145 0.14
146 0.12
147 0.07
148 0.06
149 0.05
150 0.04
151 0.04
152 0.03
153 0.04
154 0.03
155 0.03
156 0.05
157 0.05
158 0.08
159 0.11
160 0.12
161 0.12
162 0.14
163 0.15
164 0.14
165 0.2
166 0.19
167 0.17
168 0.19
169 0.21
170 0.21
171 0.22
172 0.24
173 0.2
174 0.23
175 0.22
176 0.19
177 0.18
178 0.16
179 0.15
180 0.14
181 0.14
182 0.1
183 0.13
184 0.15
185 0.16
186 0.17
187 0.17
188 0.18
189 0.19
190 0.2
191 0.17
192 0.15
193 0.15
194 0.19
195 0.19
196 0.18
197 0.16
198 0.15
199 0.16
200 0.19
201 0.23
202 0.21
203 0.23
204 0.22
205 0.22
206 0.22
207 0.2
208 0.18
209 0.12
210 0.09
211 0.06
212 0.06
213 0.05
214 0.04
215 0.04
216 0.04
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.09
226 0.13
227 0.14
228 0.15
229 0.15
230 0.16
231 0.16
232 0.16
233 0.12
234 0.09
235 0.07
236 0.06
237 0.05
238 0.06
239 0.07
240 0.07
241 0.09
242 0.11
243 0.13
244 0.15
245 0.16
246 0.14
247 0.14
248 0.14
249 0.14
250 0.14
251 0.14
252 0.12
253 0.12
254 0.12
255 0.14
256 0.14
257 0.14
258 0.12
259 0.1
260 0.14
261 0.14
262 0.14
263 0.12
264 0.12
265 0.11
266 0.11
267 0.12
268 0.07
269 0.07
270 0.07
271 0.06
272 0.06
273 0.07
274 0.06
275 0.06
276 0.06
277 0.07
278 0.08
279 0.08
280 0.09
281 0.08
282 0.11
283 0.13
284 0.16
285 0.17
286 0.24
287 0.26
288 0.3
289 0.31
290 0.3
291 0.3
292 0.33
293 0.36
294 0.34
295 0.37
296 0.35
297 0.37
298 0.37
299 0.35
300 0.31
301 0.3
302 0.27
303 0.29
304 0.37
305 0.42
306 0.47
307 0.5
308 0.52
309 0.54
310 0.55
311 0.52
312 0.47
313 0.48
314 0.42
315 0.43
316 0.4
317 0.35
318 0.32
319 0.29
320 0.24
321 0.18
322 0.23
323 0.24
324 0.26
325 0.25
326 0.29
327 0.33
328 0.33
329 0.32
330 0.29
331 0.28
332 0.3
333 0.34
334 0.34
335 0.37
336 0.45
337 0.49
338 0.49
339 0.52
340 0.52
341 0.49
342 0.51
343 0.53
344 0.49
345 0.47
346 0.49
347 0.49
348 0.46
349 0.46
350 0.46
351 0.44
352 0.46
353 0.47
354 0.44
355 0.41
356 0.44
357 0.47
358 0.5
359 0.48
360 0.46
361 0.44
362 0.46
363 0.46
364 0.46
365 0.46
366 0.43
367 0.4
368 0.42
369 0.42
370 0.44
371 0.47
372 0.48
373 0.51
374 0.51
375 0.52
376 0.51
377 0.55
378 0.57
379 0.52
380 0.47
381 0.42
382 0.35
383 0.37
384 0.35
385 0.33
386 0.28
387 0.33
388 0.4
389 0.47
390 0.48
391 0.49
392 0.53
393 0.56
394 0.62
395 0.61
396 0.6
397 0.59
398 0.66
399 0.63
400 0.62
401 0.6
402 0.54
403 0.49
404 0.45
405 0.4
406 0.3
407 0.29
408 0.22
409 0.16
410 0.14
411 0.16
412 0.15
413 0.14
414 0.14
415 0.15
416 0.15
417 0.15
418 0.17
419 0.14
420 0.15
421 0.18
422 0.21
423 0.2
424 0.22
425 0.25
426 0.27
427 0.32
428 0.32
429 0.3
430 0.29
431 0.32
432 0.33
433 0.3
434 0.27
435 0.24
436 0.24
437 0.27
438 0.3
439 0.29
440 0.26
441 0.3
442 0.32
443 0.34
444 0.33
445 0.3
446 0.35
447 0.38
448 0.41
449 0.38
450 0.38
451 0.35
452 0.37
453 0.38
454 0.38
455 0.38
456 0.42
457 0.44
458 0.43
459 0.47
460 0.46
461 0.46
462 0.41
463 0.43
464 0.41
465 0.44
466 0.44
467 0.47
468 0.47
469 0.46
470 0.42
471 0.37
472 0.37
473 0.4
474 0.41
475 0.36
476 0.4
477 0.47
478 0.53
479 0.54
480 0.53
481 0.49
482 0.48
483 0.54
484 0.57
485 0.53
486 0.48
487 0.46
488 0.43
489 0.37
490 0.35
491 0.34
492 0.25
493 0.19
494 0.17
495 0.15
496 0.15
497 0.15
498 0.15