Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J6EEJ4

Protein Details
Accession J6EEJ4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
278-307IDTRHTIAKNLRKKKHNYKFPEHWKRPEDABasic
NLS Segment(s)
PositionSequence
289-296RKKKHNYK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
IPR017081  Ribosomal_S24_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MKAPLGLWKASKVNIWSAQRRALSITRHLDNNASGGVSTATSTKEGPALPADLYMHPERWKGLPPQKILELYWERMARLGSEYKPNKDELNALLATSEYSNVSINDIKKLYYGGEQGAIDVKGGSANRDNSLRPFMFDELPSQAQELVAQHREQRFYNRLAAYELPLLAQYRQEYKRPSPKTHPVTYRYTNYVGEEHPNSRKVVLSVKTENLGLEPKSLHKFKVLATSRYDHTTDIFKMSSDKFEHASQNARYLHDILQKLLTESKNLAEDDFNDVPIDTRHTIAKNLRKKKHNYKFPEHWKRPEDAPKKNFDVVDQLLSTLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.49
4 0.5
5 0.55
6 0.52
7 0.51
8 0.48
9 0.46
10 0.43
11 0.44
12 0.46
13 0.43
14 0.44
15 0.44
16 0.42
17 0.37
18 0.33
19 0.25
20 0.18
21 0.14
22 0.13
23 0.12
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.11
31 0.13
32 0.13
33 0.15
34 0.15
35 0.16
36 0.15
37 0.16
38 0.17
39 0.15
40 0.2
41 0.2
42 0.21
43 0.21
44 0.22
45 0.22
46 0.23
47 0.27
48 0.32
49 0.38
50 0.43
51 0.45
52 0.48
53 0.5
54 0.5
55 0.44
56 0.44
57 0.41
58 0.36
59 0.38
60 0.34
61 0.3
62 0.3
63 0.3
64 0.21
65 0.2
66 0.23
67 0.19
68 0.28
69 0.33
70 0.35
71 0.37
72 0.37
73 0.35
74 0.31
75 0.32
76 0.23
77 0.24
78 0.2
79 0.18
80 0.17
81 0.15
82 0.15
83 0.12
84 0.11
85 0.05
86 0.06
87 0.07
88 0.07
89 0.1
90 0.13
91 0.14
92 0.17
93 0.17
94 0.17
95 0.16
96 0.17
97 0.15
98 0.14
99 0.15
100 0.12
101 0.14
102 0.13
103 0.13
104 0.14
105 0.13
106 0.1
107 0.09
108 0.08
109 0.08
110 0.08
111 0.09
112 0.11
113 0.13
114 0.14
115 0.16
116 0.17
117 0.17
118 0.23
119 0.21
120 0.19
121 0.2
122 0.2
123 0.2
124 0.19
125 0.19
126 0.17
127 0.17
128 0.16
129 0.14
130 0.12
131 0.11
132 0.11
133 0.1
134 0.1
135 0.11
136 0.12
137 0.15
138 0.17
139 0.19
140 0.19
141 0.24
142 0.25
143 0.26
144 0.31
145 0.28
146 0.26
147 0.26
148 0.26
149 0.21
150 0.18
151 0.15
152 0.09
153 0.09
154 0.09
155 0.08
156 0.09
157 0.08
158 0.14
159 0.16
160 0.2
161 0.24
162 0.31
163 0.41
164 0.45
165 0.5
166 0.52
167 0.6
168 0.63
169 0.66
170 0.66
171 0.61
172 0.62
173 0.61
174 0.56
175 0.5
176 0.45
177 0.38
178 0.32
179 0.3
180 0.24
181 0.22
182 0.22
183 0.22
184 0.23
185 0.24
186 0.23
187 0.22
188 0.22
189 0.19
190 0.23
191 0.24
192 0.26
193 0.27
194 0.28
195 0.28
196 0.28
197 0.26
198 0.21
199 0.19
200 0.14
201 0.12
202 0.12
203 0.15
204 0.21
205 0.22
206 0.21
207 0.21
208 0.23
209 0.23
210 0.33
211 0.34
212 0.32
213 0.35
214 0.37
215 0.36
216 0.38
217 0.37
218 0.27
219 0.24
220 0.25
221 0.22
222 0.21
223 0.2
224 0.16
225 0.19
226 0.2
227 0.24
228 0.22
229 0.23
230 0.22
231 0.26
232 0.29
233 0.28
234 0.34
235 0.29
236 0.35
237 0.35
238 0.34
239 0.32
240 0.31
241 0.33
242 0.33
243 0.33
244 0.27
245 0.28
246 0.27
247 0.27
248 0.3
249 0.26
250 0.21
251 0.21
252 0.22
253 0.22
254 0.22
255 0.22
256 0.17
257 0.18
258 0.24
259 0.23
260 0.21
261 0.18
262 0.17
263 0.17
264 0.17
265 0.21
266 0.14
267 0.15
268 0.19
269 0.2
270 0.27
271 0.35
272 0.44
273 0.49
274 0.58
275 0.66
276 0.71
277 0.8
278 0.85
279 0.87
280 0.88
281 0.87
282 0.87
283 0.89
284 0.91
285 0.92
286 0.89
287 0.88
288 0.83
289 0.77
290 0.76
291 0.76
292 0.74
293 0.74
294 0.72
295 0.71
296 0.72
297 0.72
298 0.64
299 0.54
300 0.53
301 0.45
302 0.43
303 0.35