Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164U7T7

Protein Details
Accession A0A164U7T7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-58LLAVPKKKTSHSRKRMRSANKGLQHydrophilic
NLS Segment(s)
PositionSequence
40-53KKKTSHSRKRMRSA
Subcellular Location(s) mito 13, nucl 9, cyto 2, plas 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAIAFRSTSLLSQFTQSLHIPIFQALWELFPPFLLAVPKKKTSHSRKRMRSANKGLQDKTSKRLFFDILDSADVHIGFVNCPGCGNVKLAHHICASCYSQISREWKAQQRVGNSDAESIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.19
4 0.18
5 0.18
6 0.16
7 0.17
8 0.15
9 0.14
10 0.14
11 0.11
12 0.12
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.07
21 0.09
22 0.11
23 0.13
24 0.19
25 0.24
26 0.3
27 0.31
28 0.36
29 0.45
30 0.52
31 0.61
32 0.64
33 0.7
34 0.74
35 0.82
36 0.86
37 0.84
38 0.84
39 0.82
40 0.8
41 0.77
42 0.73
43 0.65
44 0.61
45 0.6
46 0.51
47 0.47
48 0.45
49 0.37
50 0.33
51 0.34
52 0.29
53 0.23
54 0.24
55 0.21
56 0.15
57 0.16
58 0.15
59 0.13
60 0.13
61 0.11
62 0.09
63 0.07
64 0.07
65 0.06
66 0.08
67 0.08
68 0.07
69 0.08
70 0.08
71 0.1
72 0.11
73 0.13
74 0.14
75 0.15
76 0.22
77 0.23
78 0.25
79 0.24
80 0.23
81 0.23
82 0.24
83 0.24
84 0.19
85 0.2
86 0.19
87 0.19
88 0.25
89 0.3
90 0.3
91 0.35
92 0.42
93 0.49
94 0.56
95 0.59
96 0.58
97 0.59
98 0.6
99 0.56
100 0.52
101 0.44