Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164XT01

Protein Details
Accession A0A164XT01    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
131-152ESAQPPPKRPHGQKKRVAVKKGBasic
NLS Segment(s)
PositionSequence
68-73SKKRKR
135-153PPPKRPHGQKKRVAVKKGW
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPKCRRRTATAVMAGDFDPRPQRDALTSLLNGVKPYTPHPSVDARRVVPDDAPSTVDHPQGGDNESRSKKRKRPGDGMSSFWMASSVRTASSMINSPEHTPEPSDHSDYSSRSSSKRPHTPEDDLLRRSGESAQPPPKRPHGQKKRVAVKKGWKGWLEVDEDELPKDKLIELDSVPILQERRTRSGKNFDAIGEGHDTWVSRLKVLHPFIISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.32
4 0.25
5 0.24
6 0.22
7 0.25
8 0.23
9 0.25
10 0.24
11 0.27
12 0.27
13 0.25
14 0.24
15 0.25
16 0.27
17 0.26
18 0.23
19 0.22
20 0.21
21 0.16
22 0.2
23 0.24
24 0.23
25 0.24
26 0.27
27 0.35
28 0.38
29 0.44
30 0.46
31 0.39
32 0.41
33 0.42
34 0.39
35 0.32
36 0.3
37 0.25
38 0.21
39 0.21
40 0.18
41 0.19
42 0.2
43 0.19
44 0.15
45 0.14
46 0.14
47 0.14
48 0.16
49 0.15
50 0.15
51 0.22
52 0.27
53 0.33
54 0.39
55 0.46
56 0.51
57 0.58
58 0.65
59 0.65
60 0.71
61 0.72
62 0.75
63 0.7
64 0.66
65 0.61
66 0.53
67 0.44
68 0.34
69 0.27
70 0.16
71 0.13
72 0.11
73 0.08
74 0.07
75 0.08
76 0.09
77 0.08
78 0.1
79 0.12
80 0.12
81 0.13
82 0.14
83 0.14
84 0.16
85 0.16
86 0.15
87 0.13
88 0.13
89 0.17
90 0.18
91 0.2
92 0.18
93 0.19
94 0.21
95 0.2
96 0.23
97 0.2
98 0.19
99 0.18
100 0.23
101 0.28
102 0.34
103 0.41
104 0.43
105 0.47
106 0.52
107 0.55
108 0.57
109 0.58
110 0.55
111 0.48
112 0.44
113 0.38
114 0.32
115 0.28
116 0.23
117 0.19
118 0.18
119 0.24
120 0.33
121 0.38
122 0.42
123 0.45
124 0.52
125 0.57
126 0.62
127 0.66
128 0.68
129 0.73
130 0.76
131 0.82
132 0.84
133 0.83
134 0.8
135 0.76
136 0.75
137 0.75
138 0.74
139 0.71
140 0.61
141 0.56
142 0.54
143 0.5
144 0.44
145 0.34
146 0.31
147 0.26
148 0.26
149 0.24
150 0.22
151 0.18
152 0.14
153 0.15
154 0.11
155 0.1
156 0.12
157 0.14
158 0.12
159 0.15
160 0.16
161 0.15
162 0.15
163 0.16
164 0.15
165 0.15
166 0.2
167 0.22
168 0.29
169 0.35
170 0.39
171 0.44
172 0.53
173 0.55
174 0.54
175 0.51
176 0.44
177 0.42
178 0.37
179 0.33
180 0.28
181 0.23
182 0.19
183 0.18
184 0.18
185 0.16
186 0.23
187 0.21
188 0.18
189 0.2
190 0.24
191 0.32
192 0.35
193 0.38