Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5RKW3

Protein Details
Accession J5RKW3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
196-219QTEHKKGKELLQKKKENNKEPVALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.333, cyto 4.5, cyto_pero 3.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0045324  P:late endosome to vacuole transport  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGQKSSRVQITKTDRAILEVKRSKDEIHKFTRRTDGLILAERNQLKDLIRKHSDDYKCNTKVRFLLKRIHYQEHLLQQASDQLINLENMVSTLEFKMVETQFFNGLKNGNEILKKLNKEFSNVDELMDDVHDQIAYQNEINETLSRSVVGTNDYEDELNKELDALESELNSVKQDKNEVVKLPSTEGLPSLPQGEQTEHKKGKELLQKKKENNKEPVALLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.51
4 0.45
5 0.47
6 0.45
7 0.45
8 0.44
9 0.45
10 0.44
11 0.48
12 0.54
13 0.52
14 0.55
15 0.61
16 0.59
17 0.63
18 0.69
19 0.6
20 0.55
21 0.49
22 0.44
23 0.39
24 0.43
25 0.39
26 0.32
27 0.37
28 0.35
29 0.33
30 0.29
31 0.26
32 0.22
33 0.27
34 0.29
35 0.32
36 0.35
37 0.36
38 0.39
39 0.46
40 0.5
41 0.49
42 0.52
43 0.53
44 0.55
45 0.57
46 0.54
47 0.49
48 0.49
49 0.52
50 0.54
51 0.48
52 0.51
53 0.52
54 0.61
55 0.62
56 0.61
57 0.54
58 0.49
59 0.5
60 0.47
61 0.44
62 0.35
63 0.29
64 0.24
65 0.26
66 0.23
67 0.17
68 0.11
69 0.09
70 0.09
71 0.09
72 0.09
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.11
84 0.11
85 0.12
86 0.11
87 0.12
88 0.15
89 0.15
90 0.16
91 0.12
92 0.13
93 0.12
94 0.13
95 0.13
96 0.12
97 0.12
98 0.12
99 0.16
100 0.19
101 0.2
102 0.2
103 0.25
104 0.23
105 0.26
106 0.27
107 0.25
108 0.27
109 0.26
110 0.25
111 0.19
112 0.18
113 0.15
114 0.13
115 0.11
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.09
129 0.1
130 0.1
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.08
138 0.09
139 0.1
140 0.1
141 0.1
142 0.1
143 0.11
144 0.12
145 0.11
146 0.1
147 0.09
148 0.08
149 0.09
150 0.1
151 0.09
152 0.08
153 0.08
154 0.09
155 0.1
156 0.1
157 0.11
158 0.12
159 0.13
160 0.14
161 0.17
162 0.2
163 0.25
164 0.29
165 0.31
166 0.31
167 0.33
168 0.32
169 0.32
170 0.29
171 0.24
172 0.21
173 0.18
174 0.17
175 0.15
176 0.14
177 0.14
178 0.13
179 0.14
180 0.16
181 0.19
182 0.24
183 0.29
184 0.39
185 0.41
186 0.42
187 0.45
188 0.46
189 0.52
190 0.55
191 0.59
192 0.6
193 0.66
194 0.75
195 0.79
196 0.87
197 0.88
198 0.87
199 0.87
200 0.83
201 0.78