Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164ZGV6

Protein Details
Accession A0A164ZGV6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-45GLENRKTRTRRTHHTNNPLTTTSSARNRKWYQRKNPNRRAGGLHydrophilic
NLS Segment(s)
PositionSequence
36-41KNPNRR
Subcellular Location(s) nucl 13, mito_nucl 12.5, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFGLENRKTRTRRTHHTNNPLTTTSSARNRKWYQRKNPNRRAGGLKAALHNPNTTSHGRKNAKHELRAMGRGNEAHVPFSVRVRHWFGMHGNSRRRSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.87
4 0.87
5 0.81
6 0.76
7 0.67
8 0.6
9 0.51
10 0.44
11 0.39
12 0.4
13 0.43
14 0.4
15 0.48
16 0.52
17 0.61
18 0.68
19 0.72
20 0.74
21 0.77
22 0.86
23 0.88
24 0.93
25 0.91
26 0.84
27 0.78
28 0.73
29 0.64
30 0.59
31 0.52
32 0.44
33 0.36
34 0.36
35 0.33
36 0.28
37 0.25
38 0.19
39 0.17
40 0.19
41 0.19
42 0.2
43 0.22
44 0.31
45 0.36
46 0.39
47 0.45
48 0.52
49 0.55
50 0.55
51 0.55
52 0.52
53 0.51
54 0.54
55 0.49
56 0.4
57 0.36
58 0.32
59 0.31
60 0.29
61 0.25
62 0.2
63 0.18
64 0.19
65 0.18
66 0.22
67 0.25
68 0.21
69 0.27
70 0.32
71 0.35
72 0.32
73 0.36
74 0.35
75 0.4
76 0.47
77 0.51
78 0.53
79 0.59