Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WD23

Protein Details
Accession G0WD23   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
128-150DEDRRIAQRWKKRGEKIKYLYGSHydrophilic
NLS Segment(s)
PositionSequence
63-81NIALKEKFKGERWAPKKKL
136-141RWKKRG
Subcellular Location(s) mito 18.5, mito_nucl 14, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG ndi:NDAI_0F03660  -  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MNVLLKLCRSFSQASYNVTLLKESKGKIISGKKIIKWVNDSSLSKKEMGKIDKEKMDTWKRQNIALKEKFKGERWAPKKKLSRTEMGSVRLLREQFPDMTASELGEKFKVSPEAIRRILKSNWKPSEDEDRRIAQRWKKRGEKIKYLYGSTRLGDERVSASTVDPGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.38
4 0.35
5 0.32
6 0.32
7 0.24
8 0.24
9 0.24
10 0.22
11 0.26
12 0.25
13 0.26
14 0.32
15 0.39
16 0.42
17 0.47
18 0.53
19 0.49
20 0.56
21 0.58
22 0.54
23 0.52
24 0.48
25 0.44
26 0.45
27 0.46
28 0.42
29 0.45
30 0.42
31 0.38
32 0.36
33 0.35
34 0.36
35 0.37
36 0.4
37 0.41
38 0.45
39 0.47
40 0.48
41 0.46
42 0.48
43 0.53
44 0.52
45 0.52
46 0.53
47 0.5
48 0.52
49 0.56
50 0.53
51 0.55
52 0.56
53 0.54
54 0.48
55 0.52
56 0.49
57 0.45
58 0.47
59 0.41
60 0.43
61 0.46
62 0.55
63 0.54
64 0.6
65 0.66
66 0.65
67 0.7
68 0.63
69 0.62
70 0.55
71 0.58
72 0.53
73 0.48
74 0.44
75 0.35
76 0.33
77 0.29
78 0.25
79 0.19
80 0.17
81 0.16
82 0.13
83 0.14
84 0.14
85 0.11
86 0.13
87 0.12
88 0.1
89 0.1
90 0.11
91 0.11
92 0.1
93 0.1
94 0.09
95 0.1
96 0.13
97 0.11
98 0.16
99 0.21
100 0.28
101 0.33
102 0.36
103 0.35
104 0.38
105 0.42
106 0.47
107 0.5
108 0.53
109 0.54
110 0.54
111 0.54
112 0.53
113 0.6
114 0.55
115 0.52
116 0.46
117 0.45
118 0.45
119 0.49
120 0.52
121 0.49
122 0.54
123 0.58
124 0.64
125 0.67
126 0.74
127 0.79
128 0.81
129 0.83
130 0.8
131 0.81
132 0.75
133 0.7
134 0.65
135 0.59
136 0.53
137 0.43
138 0.41
139 0.32
140 0.29
141 0.25
142 0.23
143 0.2
144 0.19
145 0.19
146 0.15
147 0.14
148 0.2