Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164RI00

Protein Details
Accession A0A164RI00    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRRRGNRIYRRPKRRFLYQNLRRWIGRBasic
NLS Segment(s)
PositionSequence
4-14RGNRIYRRPKR
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRRRGNRIYRRPKRRFLYQNLRRWIGRLLCQPGMEDILDRPLVNDDPPVEMKDVWDGKCFREFLGPDGLPFITGPRMPGEGRLMFGLNIDGFNPFGNKQAGKKKSTGAIYLVCFNLPPTSRYLIDNMILIGVIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.86
4 0.86
5 0.85
6 0.86
7 0.83
8 0.8
9 0.69
10 0.61
11 0.57
12 0.51
13 0.47
14 0.45
15 0.44
16 0.42
17 0.42
18 0.4
19 0.34
20 0.31
21 0.24
22 0.17
23 0.12
24 0.12
25 0.12
26 0.12
27 0.11
28 0.11
29 0.12
30 0.11
31 0.12
32 0.1
33 0.12
34 0.14
35 0.14
36 0.13
37 0.13
38 0.13
39 0.17
40 0.2
41 0.18
42 0.21
43 0.21
44 0.21
45 0.25
46 0.25
47 0.2
48 0.21
49 0.21
50 0.18
51 0.24
52 0.23
53 0.19
54 0.2
55 0.19
56 0.14
57 0.14
58 0.12
59 0.06
60 0.07
61 0.08
62 0.07
63 0.1
64 0.09
65 0.11
66 0.15
67 0.14
68 0.14
69 0.14
70 0.14
71 0.12
72 0.12
73 0.11
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.07
82 0.1
83 0.13
84 0.14
85 0.2
86 0.3
87 0.35
88 0.37
89 0.39
90 0.4
91 0.44
92 0.45
93 0.41
94 0.35
95 0.34
96 0.33
97 0.33
98 0.3
99 0.24
100 0.21
101 0.19
102 0.21
103 0.17
104 0.17
105 0.18
106 0.22
107 0.23
108 0.25
109 0.27
110 0.25
111 0.25
112 0.25
113 0.2
114 0.16