Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5PS36

Protein Details
Accession J5PS36   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-93LTEGGLKGKSKRKKRTKVTLETISEEHydrophilic
NLS Segment(s)
PositionSequence
74-83KGKSKRKKRT
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQSVSNCPIGLVSKDTINSAATFTGWVACPWKYINVVGSGRYVSNKPDKITRYDLLKAAHDAEMQELLTEGGLKGKSKRKKRTKVTLETISEENSSNESIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.17
5 0.16
6 0.13
7 0.12
8 0.1
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.1
15 0.1
16 0.12
17 0.12
18 0.14
19 0.14
20 0.14
21 0.15
22 0.18
23 0.19
24 0.18
25 0.18
26 0.17
27 0.16
28 0.17
29 0.16
30 0.13
31 0.2
32 0.22
33 0.22
34 0.27
35 0.29
36 0.32
37 0.37
38 0.35
39 0.32
40 0.32
41 0.34
42 0.29
43 0.29
44 0.25
45 0.21
46 0.19
47 0.15
48 0.13
49 0.11
50 0.1
51 0.09
52 0.08
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.07
59 0.08
60 0.09
61 0.16
62 0.25
63 0.34
64 0.44
65 0.55
66 0.63
67 0.73
68 0.83
69 0.88
70 0.9
71 0.91
72 0.9
73 0.88
74 0.81
75 0.75
76 0.66
77 0.57
78 0.47
79 0.38
80 0.3
81 0.22