Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164ZTV8

Protein Details
Accession A0A164ZTV8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPKSHHydrophilic
NLS Segment(s)
PositionSequence
14-50KKAHRNGIKKPKSHRTLSMKGVDSKFRKNALFARRGS
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKSHRTLSMKGVDSKFRKNALFARRGSTKARLEAKTGGDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.82
9 0.78
10 0.78
11 0.79
12 0.75
13 0.7
14 0.69
15 0.66
16 0.64
17 0.64
18 0.61
19 0.54
20 0.52
21 0.5
22 0.48
23 0.43
24 0.42
25 0.4
26 0.38
27 0.36
28 0.34
29 0.4
30 0.41
31 0.46
32 0.42
33 0.44
34 0.44
35 0.46
36 0.47
37 0.48
38 0.44
39 0.45
40 0.52
41 0.48
42 0.48
43 0.5