Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5RU77

Protein Details
Accession J5RU77    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28VKKSSSDEKSLKKRQKIDFSEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039971  CWC24-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MFRKRIVKKSSSDEKSLKKRQKIDFSEEKPVTSDGENDFCGKIPLAKAGRGKELRPARADYREQCRNSEDSDKYSLTVNDDSTRENLLNFERRELAEKMKKKRSNENNELVLNMSGKSAQSTRKINQPTNIRTTVLMDFQPDVCKDYKQTGYCGYGDSCKFLHSRDDFKTGWKLNQEWNVGGEGSRKARWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.79
4 0.78
5 0.76
6 0.79
7 0.81
8 0.84
9 0.81
10 0.79
11 0.79
12 0.75
13 0.77
14 0.69
15 0.6
16 0.51
17 0.45
18 0.37
19 0.27
20 0.26
21 0.18
22 0.2
23 0.2
24 0.2
25 0.2
26 0.18
27 0.18
28 0.15
29 0.14
30 0.12
31 0.19
32 0.19
33 0.24
34 0.29
35 0.3
36 0.39
37 0.39
38 0.38
39 0.4
40 0.45
41 0.45
42 0.44
43 0.46
44 0.42
45 0.46
46 0.51
47 0.48
48 0.49
49 0.53
50 0.51
51 0.48
52 0.46
53 0.42
54 0.4
55 0.41
56 0.35
57 0.29
58 0.32
59 0.3
60 0.28
61 0.27
62 0.24
63 0.19
64 0.19
65 0.16
66 0.15
67 0.15
68 0.16
69 0.15
70 0.16
71 0.13
72 0.12
73 0.12
74 0.13
75 0.19
76 0.18
77 0.18
78 0.18
79 0.19
80 0.23
81 0.23
82 0.27
83 0.28
84 0.35
85 0.41
86 0.5
87 0.54
88 0.54
89 0.62
90 0.66
91 0.68
92 0.7
93 0.68
94 0.63
95 0.59
96 0.55
97 0.46
98 0.36
99 0.26
100 0.18
101 0.11
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.18
108 0.23
109 0.25
110 0.33
111 0.39
112 0.4
113 0.45
114 0.51
115 0.5
116 0.51
117 0.51
118 0.44
119 0.39
120 0.39
121 0.33
122 0.26
123 0.21
124 0.16
125 0.15
126 0.15
127 0.18
128 0.15
129 0.16
130 0.15
131 0.16
132 0.17
133 0.22
134 0.28
135 0.27
136 0.29
137 0.31
138 0.33
139 0.33
140 0.33
141 0.28
142 0.28
143 0.26
144 0.26
145 0.22
146 0.21
147 0.21
148 0.2
149 0.27
150 0.26
151 0.32
152 0.34
153 0.4
154 0.38
155 0.43
156 0.51
157 0.45
158 0.46
159 0.45
160 0.43
161 0.45
162 0.52
163 0.51
164 0.43
165 0.41
166 0.37
167 0.31
168 0.29
169 0.25
170 0.23
171 0.24