Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164M9A5

Protein Details
Accession A0A164M9A5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-99KYKLEYFRAKKWKKKWIKQAEAIVREHydrophilic
NLS Segment(s)
PositionSequence
82-89AKKWKKKW
Subcellular Location(s) cyto 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences TVSLSVANKPLIHQVIPVIDHLTTKLATAADDESGNTSLIVRHGSANGVEVLNKYYSKTDESVMYRVAMVLHPKYKLEYFRAKKWKKKWIKQAEAIVREIWKRDYLPKVVQNVPPKPVRDQFIHGMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.23
5 0.17
6 0.15
7 0.15
8 0.15
9 0.14
10 0.11
11 0.1
12 0.11
13 0.1
14 0.09
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.11
23 0.09
24 0.09
25 0.08
26 0.09
27 0.1
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.08
37 0.08
38 0.09
39 0.1
40 0.1
41 0.09
42 0.09
43 0.11
44 0.12
45 0.13
46 0.13
47 0.16
48 0.18
49 0.18
50 0.18
51 0.17
52 0.14
53 0.13
54 0.13
55 0.09
56 0.1
57 0.11
58 0.12
59 0.13
60 0.13
61 0.15
62 0.17
63 0.19
64 0.22
65 0.3
66 0.33
67 0.42
68 0.53
69 0.59
70 0.65
71 0.71
72 0.76
73 0.77
74 0.82
75 0.83
76 0.83
77 0.85
78 0.84
79 0.85
80 0.83
81 0.76
82 0.68
83 0.58
84 0.5
85 0.42
86 0.36
87 0.29
88 0.22
89 0.21
90 0.26
91 0.31
92 0.34
93 0.4
94 0.44
95 0.48
96 0.52
97 0.56
98 0.59
99 0.57
100 0.58
101 0.56
102 0.53
103 0.54
104 0.54
105 0.52
106 0.47
107 0.49