Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164QSJ4

Protein Details
Accession A0A164QSJ4    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
186-207ASLKDEKAKSKRKKTGEKEAKEBasic
223-244GSGKPGQRKAKGKKKAGNGKETBasic
NLS Segment(s)
PositionSequence
192-204KAKSKRKKTGEKE
226-240KPGQRKAKGKKKAGN
289-307GRGKKRAKGDDGGSKKKAK
Subcellular Location(s) cyto_nucl 14, nucl 13, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MDDHDPISQFFPDDEDVDLYAVLSLTEEASLDDIKKSYRRFALLNHPDKHVNSSEEARNAAALKFQQVGFAYAVLSDEKRRKRYDTTGKTDEGFELGAGEDGWEAYFEELFEKVTKGRLDELKKEYQGSAEEITDVRSAYLETEGSIDEILARIPHSNYTDEPRFIEMISKAIKDGELIAFPAWEASLKDEKAKSKRKKTGEKEAKEAEETAKELGVWDEFYGSGKPGQRKAKGKKKAGNGKETEQDGAEAEDDEHAALRALIQKNRSKMNSVVDSLAAKYGGESNEGGRGKKRAKGDDGGSKKKAKVAAAPEIDDDEFEKLQQSLFGEKASAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.15
5 0.15
6 0.12
7 0.1
8 0.09
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.05
16 0.07
17 0.09
18 0.09
19 0.1
20 0.11
21 0.15
22 0.21
23 0.23
24 0.29
25 0.33
26 0.36
27 0.37
28 0.42
29 0.49
30 0.54
31 0.61
32 0.56
33 0.55
34 0.55
35 0.54
36 0.53
37 0.45
38 0.37
39 0.32
40 0.35
41 0.36
42 0.34
43 0.34
44 0.29
45 0.27
46 0.25
47 0.22
48 0.19
49 0.15
50 0.15
51 0.17
52 0.17
53 0.18
54 0.18
55 0.2
56 0.17
57 0.16
58 0.14
59 0.11
60 0.12
61 0.1
62 0.11
63 0.14
64 0.22
65 0.29
66 0.35
67 0.39
68 0.43
69 0.49
70 0.58
71 0.64
72 0.66
73 0.68
74 0.67
75 0.65
76 0.62
77 0.55
78 0.45
79 0.34
80 0.24
81 0.15
82 0.1
83 0.08
84 0.07
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.07
98 0.07
99 0.08
100 0.08
101 0.12
102 0.13
103 0.13
104 0.18
105 0.24
106 0.28
107 0.35
108 0.4
109 0.41
110 0.42
111 0.42
112 0.37
113 0.32
114 0.29
115 0.24
116 0.19
117 0.13
118 0.13
119 0.12
120 0.13
121 0.12
122 0.1
123 0.08
124 0.07
125 0.07
126 0.06
127 0.07
128 0.06
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.08
143 0.09
144 0.11
145 0.12
146 0.18
147 0.2
148 0.2
149 0.2
150 0.2
151 0.18
152 0.17
153 0.18
154 0.12
155 0.13
156 0.14
157 0.13
158 0.11
159 0.11
160 0.11
161 0.08
162 0.09
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.04
171 0.04
172 0.04
173 0.07
174 0.11
175 0.12
176 0.15
177 0.18
178 0.25
179 0.33
180 0.44
181 0.5
182 0.56
183 0.65
184 0.71
185 0.79
186 0.8
187 0.83
188 0.83
189 0.78
190 0.74
191 0.7
192 0.62
193 0.52
194 0.46
195 0.36
196 0.26
197 0.23
198 0.17
199 0.12
200 0.1
201 0.09
202 0.09
203 0.08
204 0.07
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.08
211 0.11
212 0.15
213 0.19
214 0.26
215 0.34
216 0.41
217 0.5
218 0.6
219 0.67
220 0.73
221 0.78
222 0.78
223 0.81
224 0.83
225 0.81
226 0.8
227 0.74
228 0.69
229 0.65
230 0.59
231 0.5
232 0.39
233 0.32
234 0.23
235 0.19
236 0.15
237 0.09
238 0.08
239 0.07
240 0.07
241 0.07
242 0.06
243 0.06
244 0.05
245 0.05
246 0.06
247 0.13
248 0.17
249 0.21
250 0.27
251 0.32
252 0.37
253 0.44
254 0.45
255 0.42
256 0.42
257 0.47
258 0.46
259 0.43
260 0.4
261 0.34
262 0.33
263 0.29
264 0.26
265 0.18
266 0.12
267 0.11
268 0.13
269 0.12
270 0.13
271 0.13
272 0.13
273 0.21
274 0.23
275 0.24
276 0.23
277 0.31
278 0.33
279 0.38
280 0.44
281 0.44
282 0.49
283 0.55
284 0.58
285 0.61
286 0.67
287 0.7
288 0.68
289 0.66
290 0.61
291 0.59
292 0.56
293 0.48
294 0.47
295 0.46
296 0.5
297 0.48
298 0.48
299 0.45
300 0.44
301 0.4
302 0.33
303 0.27
304 0.2
305 0.16
306 0.15
307 0.16
308 0.13
309 0.13
310 0.15
311 0.16
312 0.16
313 0.17
314 0.18