Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164WVH9

Protein Details
Accession A0A164WVH9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MPKEAKPKRKAAEKVEKARSSKKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
3-31KEAKPKRKAAEKVEKARSSKKKDPNAPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEAKPKRKAAEKVEKARSSKKKDPNAPKRALSAYMFFSQDWRERIKTENPDAGFGEVGKLLGAKWKELDESEKKPYIERAAKDKQRAEEEKADYGAKAGSGDDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.83
4 0.77
5 0.79
6 0.79
7 0.77
8 0.76
9 0.76
10 0.76
11 0.8
12 0.86
13 0.87
14 0.87
15 0.84
16 0.76
17 0.71
18 0.63
19 0.56
20 0.46
21 0.38
22 0.31
23 0.27
24 0.26
25 0.21
26 0.2
27 0.2
28 0.22
29 0.21
30 0.21
31 0.2
32 0.2
33 0.25
34 0.3
35 0.34
36 0.34
37 0.37
38 0.33
39 0.34
40 0.33
41 0.29
42 0.22
43 0.16
44 0.12
45 0.07
46 0.06
47 0.05
48 0.04
49 0.04
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.11
56 0.12
57 0.19
58 0.21
59 0.26
60 0.31
61 0.34
62 0.34
63 0.34
64 0.37
65 0.39
66 0.4
67 0.38
68 0.41
69 0.47
70 0.54
71 0.6
72 0.61
73 0.58
74 0.61
75 0.62
76 0.6
77 0.58
78 0.56
79 0.52
80 0.49
81 0.44
82 0.35
83 0.31
84 0.25
85 0.16
86 0.13
87 0.1
88 0.09