Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164QU95

Protein Details
Accession A0A164QU95    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
195-224PETGEPPAKRPRGRPKGSKNKPKILPQPTSHydrophilic
NLS Segment(s)
PositionSequence
201-218PAKRPRGRPKGSKNKPKI
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MQSVVQQQQQQQQQTQQSTQPHSLVNVSNIPVQEPYPKPIVAQGHDWTKNLIQLAKTAELKKHALTLQLHTAHILAAHASLDQKNKALQDIKEQKNRIESERKRLLDDLAQINSDRDKIDISESSITKETADLRSKIQSLTDGPYAVAKRDVDVLRQELGQPPLPSLQSTLEERNAANMSNTSGSTSMPETQRNPETGEPPAKRPRGRPKGSKNKPKILPQPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.53
4 0.53
5 0.53
6 0.53
7 0.48
8 0.4
9 0.37
10 0.37
11 0.33
12 0.29
13 0.27
14 0.24
15 0.25
16 0.24
17 0.23
18 0.21
19 0.2
20 0.24
21 0.23
22 0.24
23 0.25
24 0.25
25 0.24
26 0.29
27 0.33
28 0.27
29 0.3
30 0.31
31 0.36
32 0.38
33 0.39
34 0.36
35 0.31
36 0.31
37 0.28
38 0.26
39 0.18
40 0.19
41 0.22
42 0.24
43 0.27
44 0.27
45 0.27
46 0.29
47 0.3
48 0.28
49 0.28
50 0.25
51 0.27
52 0.26
53 0.27
54 0.31
55 0.31
56 0.3
57 0.26
58 0.25
59 0.19
60 0.17
61 0.14
62 0.06
63 0.05
64 0.05
65 0.05
66 0.06
67 0.08
68 0.11
69 0.11
70 0.12
71 0.14
72 0.14
73 0.17
74 0.2
75 0.19
76 0.27
77 0.37
78 0.43
79 0.48
80 0.49
81 0.47
82 0.49
83 0.51
84 0.45
85 0.46
86 0.42
87 0.45
88 0.52
89 0.52
90 0.46
91 0.45
92 0.41
93 0.33
94 0.34
95 0.27
96 0.19
97 0.19
98 0.17
99 0.17
100 0.16
101 0.14
102 0.1
103 0.07
104 0.07
105 0.07
106 0.09
107 0.09
108 0.11
109 0.14
110 0.14
111 0.16
112 0.16
113 0.16
114 0.14
115 0.14
116 0.14
117 0.16
118 0.2
119 0.19
120 0.2
121 0.23
122 0.23
123 0.22
124 0.21
125 0.17
126 0.15
127 0.17
128 0.17
129 0.14
130 0.14
131 0.17
132 0.17
133 0.16
134 0.17
135 0.13
136 0.13
137 0.19
138 0.19
139 0.18
140 0.2
141 0.22
142 0.2
143 0.2
144 0.21
145 0.18
146 0.21
147 0.23
148 0.2
149 0.19
150 0.21
151 0.21
152 0.2
153 0.18
154 0.17
155 0.16
156 0.19
157 0.21
158 0.21
159 0.22
160 0.21
161 0.23
162 0.22
163 0.19
164 0.17
165 0.14
166 0.14
167 0.15
168 0.15
169 0.12
170 0.12
171 0.12
172 0.13
173 0.15
174 0.17
175 0.19
176 0.24
177 0.25
178 0.32
179 0.35
180 0.35
181 0.37
182 0.35
183 0.35
184 0.38
185 0.45
186 0.41
187 0.45
188 0.53
189 0.57
190 0.58
191 0.65
192 0.7
193 0.71
194 0.78
195 0.81
196 0.83
197 0.86
198 0.92
199 0.93
200 0.92
201 0.91
202 0.89
203 0.89
204 0.88