Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164S7N6

Protein Details
Accession A0A164S7N6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-120PLDLRPKKTRAIRRRLTPHERSRKTVKQHKKEIHFPQRKFBasic
NLS Segment(s)
PositionSequence
83-120DLRPKKTRAIRRRLTPHERSRKTVKQHKKEIHFPQRKF
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKTDLAKQLAELKQELLTLRVQKIAGGSASKLTKINTVRKSIARVLTVTNQKARQNLREFYKGKKYLPLDLRPKKTRAIRRRLTPHERSRKTVKQHKKEIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.39
4 0.44
5 0.4
6 0.39
7 0.38
8 0.44
9 0.42
10 0.41
11 0.38
12 0.3
13 0.26
14 0.24
15 0.22
16 0.15
17 0.17
18 0.18
19 0.18
20 0.19
21 0.18
22 0.18
23 0.18
24 0.17
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.25
46 0.28
47 0.31
48 0.28
49 0.28
50 0.28
51 0.29
52 0.33
53 0.33
54 0.35
55 0.35
56 0.38
57 0.4
58 0.45
59 0.45
60 0.45
61 0.53
62 0.49
63 0.44
64 0.47
65 0.44
66 0.43
67 0.49
68 0.53
69 0.53
70 0.59
71 0.67
72 0.65
73 0.65
74 0.64
75 0.66
76 0.67
77 0.67
78 0.69
79 0.69
80 0.74
81 0.82
82 0.84
83 0.85
84 0.84
85 0.85
86 0.86
87 0.82
88 0.78
89 0.78
90 0.76
91 0.77
92 0.77
93 0.78
94 0.77
95 0.83
96 0.86
97 0.85
98 0.87
99 0.88
100 0.88
101 0.87
102 0.79
103 0.78
104 0.78