Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164V270

Protein Details
Accession A0A164V270   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-92YFELSETRRKPKKTKENEDHIQKRRKRYFRVFLMHydrophilic
NLS Segment(s)
PositionSequence
66-85RRKPKKTKENEDHIQKRRKR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSDTRLLTNTECLRGVTMIDSRGVHSLRHNNLEIRTYKRERKLSRETVTRYMLRNSMSYFELSETRRKPKKTKENEDHIQKRRKRYFRVFLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.17
4 0.16
5 0.14
6 0.15
7 0.15
8 0.15
9 0.19
10 0.19
11 0.17
12 0.21
13 0.28
14 0.29
15 0.33
16 0.34
17 0.33
18 0.33
19 0.37
20 0.35
21 0.33
22 0.37
23 0.39
24 0.44
25 0.49
26 0.56
27 0.56
28 0.61
29 0.64
30 0.65
31 0.65
32 0.65
33 0.62
34 0.58
35 0.58
36 0.52
37 0.45
38 0.38
39 0.34
40 0.28
41 0.25
42 0.21
43 0.19
44 0.17
45 0.15
46 0.14
47 0.13
48 0.16
49 0.17
50 0.24
51 0.26
52 0.35
53 0.42
54 0.47
55 0.54
56 0.61
57 0.71
58 0.74
59 0.81
60 0.81
61 0.84
62 0.88
63 0.9
64 0.89
65 0.88
66 0.87
67 0.82
68 0.83
69 0.83
70 0.83
71 0.82
72 0.83