Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164QR95

Protein Details
Accession A0A164QR95    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-101TAQQRHEKEGPKRRRLRSERWRRRFAEEVBasic
NLS Segment(s)
PositionSequence
79-116EKEGPKRRRLRSERWRRRFAEEVRKKVRLVEAIRRRGA
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MLQEVKVPPAPARTVQTPAEAWTLQSQRFQAKNPKPDNAYSGRSIQIKDGELSSAWMYLQRILRDNNVRAEATAQQRHEKEGPKRRRLRSERWRRRFAEEVRKKVRLVEAIRRRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.31
5 0.3
6 0.3
7 0.24
8 0.22
9 0.24
10 0.26
11 0.24
12 0.26
13 0.26
14 0.3
15 0.32
16 0.36
17 0.39
18 0.45
19 0.53
20 0.55
21 0.59
22 0.55
23 0.54
24 0.54
25 0.49
26 0.44
27 0.37
28 0.34
29 0.31
30 0.3
31 0.29
32 0.25
33 0.23
34 0.2
35 0.18
36 0.16
37 0.13
38 0.11
39 0.12
40 0.1
41 0.08
42 0.07
43 0.07
44 0.07
45 0.1
46 0.13
47 0.12
48 0.15
49 0.16
50 0.21
51 0.25
52 0.27
53 0.27
54 0.27
55 0.26
56 0.23
57 0.24
58 0.24
59 0.25
60 0.28
61 0.26
62 0.3
63 0.31
64 0.35
65 0.37
66 0.4
67 0.44
68 0.5
69 0.59
70 0.64
71 0.73
72 0.76
73 0.83
74 0.83
75 0.84
76 0.85
77 0.86
78 0.87
79 0.87
80 0.89
81 0.81
82 0.81
83 0.79
84 0.77
85 0.77
86 0.76
87 0.77
88 0.76
89 0.76
90 0.68
91 0.64
92 0.6
93 0.57
94 0.54
95 0.55
96 0.57