Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164QL97

Protein Details
Accession A0A164QL97    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPRSSKARPKPKFVRLHPDDBasic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 6, cyto 5.5, nucl 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024047  MM3350-like_sf  
Amino Acid Sequences MPPRSSKARPKPKFVRLHPDDPADLLDPVFLEISGGINLEAFQDKVLQPIMGWDRNAHAYLFTDLSDGAGFGPRDASTVDISHKDSVGYEFLHADEYILAHLLQSEGEAFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.79
4 0.79
5 0.74
6 0.68
7 0.58
8 0.48
9 0.43
10 0.33
11 0.26
12 0.19
13 0.14
14 0.1
15 0.1
16 0.09
17 0.06
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.07
31 0.07
32 0.08
33 0.09
34 0.08
35 0.07
36 0.11
37 0.14
38 0.14
39 0.14
40 0.13
41 0.14
42 0.16
43 0.16
44 0.12
45 0.09
46 0.09
47 0.1
48 0.1
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.05
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.09
65 0.1
66 0.12
67 0.14
68 0.16
69 0.17
70 0.17
71 0.15
72 0.14
73 0.15
74 0.15
75 0.13
76 0.12
77 0.11
78 0.11
79 0.13
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.08
86 0.08
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06